SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML226712a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML226712a-PA
Domain Number 1 Region: 749-930,999-1103
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.46e-19
Family Rhodopsin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 667-702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 261-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 483-508
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 704-735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000275
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML226712a-PA
Sequence length 1212
Comment pep supercontig:GCA_000226015.1:ML2267:126247:129885:-1 gene:ML226712a transcript:ML226712a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLLTLLPTIITTTSPTTISTESVRLAADNQTVEVQVEGVWYEVNTPRLTDRVARAACR
TFMNMEFGYFHIVHPPQNKQFYSRVLVKECSLFGKFPEDCQIEVYDNVTECHTMNRLKIT
CASDLRNCQDIVEDGFMRKICYIGREKVYRCLSSPDQIYRYVVPKNAEFGPVGCVFSDVC
EPAEYRDHYQACGCEGVDTEDRTCNTVVCPIHDPALRHITTPIQTVSSYAICNGYSSCLS
GLDEADELCAGKKYHYCTRLTTVFPETNPRDTGWIPRSAMCDSRAHCTDGSDEVNCGHDF
GIYCHPTANPEVMGWFNNAYRCDKKQQCADGSDELDCDNPPGFNCTKVGFDFSGKNSQKE
IFVPDYLRCVQPFSDELFDYECDGFIDQMNCTNVNVVNCTVSNGLVAYPNTSVRSLWTCD
DTQMCDNSDDELGCHLLPGCKVHKHRHCDGIDDCEGRDEKNCVFYPEFSCQRKYIGPTPN
PNMPFPSKWLCDGVEDCIDGSDETHSSCVSYSGLHCPGSNTTVPYSYLCDYSESCSETSN
AETDLCAFSKESKLPVQEILLDRFVPPCLPGLVTESSSSPIKCATSQGYTGLGGALLTSP
STKRPCYNTFGPTYTALACNGVCLEGSSCSLSDISRVPCAEGLQSDIKKTLNPVSNKLEN
VFVHGTTVDSIGFRCNNTKCISKEKVCNLNDDCGDGSDEVGCANSFKCKEGFPNYIPRSK
QCDGQHDCSDSSDECSPECGSLRLISSDVMCVIAVIIALAATLINFLTLVDRLPDAFKPP
RDSLTVSYTNDCLVNLIAFGDLCIGVYLLNIVAMHYTYSDNYCIQQFDWLTTKHCDFLGV
LSTFGTQLSLFSMVVLGCFRAHSILFPFHQKSLSFSFRVKIVVIEILVIILSATIAVIPI
VPISSFRKYFNNGRFYLKNTFFKRLTTFDEHTAIHQKYLSYLNTNKSSALNTTIGSWEDI
SKVFDLQIFNDTSDGRLLNFYGSDGVCIFKYIVSDDNTQLTYSMSVVAVNFFCFILIAVS
YLIILFSVRSGGVSVSNTKRKQLETLQRKVALIIATDFLCWIPFCVICLLHATHTIDADP
YYDFFSIIFIPINSVFNPIIYNGLDMVRRVRKVVKEGRKSVSTVLSRVSVVDDSKLSGLQ
NNGRRSLVSRKPSVGQQKGRRHTLGELQGGRSRLSSVGLRQQASSGDLALRQQDRDCGGS
RRHLEQIEESDV
Download sequence
Identical sequences ML226712a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]