SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML279842a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML279842a-PA
Domain Number 1 Region: 791-967,1036-1138
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.2e-19
Family Rhodopsin-like 0.0087
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000153
Family Fucose binding lectin 0.024
Further Details:      
 
Domain Number 3 Region: 106-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 748-783
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000746
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 5 Region: 713-747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000982
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML279842a-PA
Sequence length 1214
Comment pep supercontig:GCA_000226015.1:ML2798:461317:465358:-1 gene:ML279842a transcript:ML279842a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPESCPRSDGAAWWRLEFPTEVQIDWVKIWNRIGGQSKRIDKVKVFLDRRDRDRYICGE
IEYIKKENRYNYTISCGGIVTKAITIENNCVLTLCEVEVFTSKPPRLCSGYTVKNGTVYP
AEVIEGSIVNISCDLGFRMTGKSRLMCKNGTVGELPRCIPLEKDECKPGTFGGFLQYICQ
DGQNKDKITMKCANSDIIYHITRDSETSELIFSHVCENDNKFYQACGSFGRTDVYAIDTE
KLFCGGYICKDRGKITSATCWSQKTPGSCDNIKKKEELCTNELDGENNLIEKCDGICNQQ
SKCLDEAYCNGFTYGRNCEENHFYLSVLRTSEREKSSKNKKCKVFDSWPENMAAFLENYT
EPVCEQTISKKVFPIFNFTRCAAFRYDQSAVFDPDSWWITSTKMPYCTNLMDQTNCTDLS
RVAFSCTVNGYSTNISRLAICHEMNEVRLCDDGLENDCKHVSPSCFLHKHKMCDGIIDCL
DESDEQSVECNRTTEKTCIRVYGNRSLPTPITWLGDGIADCVSGEESMWPTCGEGETKRF
VRDNGSCHDDYLCPNSETKFVPWTQLCDMIETCGNENTVCSLSKGKTKLETKVFIQNKNE
RFKYFSYCIRCLGNLQSLAKSCKKERFIFPPGKTLGIDEPTIIEFPDQSINCNYVYGEAY
VLASCTGNCKASKCPLSRKLQYDSCVGQFPKRIYTVTNMETLTFVTPFKGSFHNDYFLGK
NLGCVTYDKVCDLVDHCGDESDETNCTNHFHCNSSRTRIPVWQKCDGHLNCEDLSDECND
ACGKEIIEGNFLKISSWVIGSLAVILNSFIIITSVKSLKGLETSTGLLNKMLIILISFGD
FLVAGYLFTISAADFIYGPSYCSSQTEWLSSHYCSILGILSTVGSQISLFSMTFLSVARL
FGIKNAMSIPRGLSFKFCIEVSAVVFLIVFSAITIATVPILSQFENFFVNGMSYKKIEPM
FLGLPDKDVHLQVVNAYYGRAKGDKSSISWKTILELIDGMFTKLYSKGLSRRKVDFYGND
GVCLFKYFVTDGDPQRIFSWAILTVNLTCFVCISISYFIITTLSVNSSRSVVNEQISKRN
RKMQRKISIIIATDFCCWIPFVVICCLHSLSVLDATPWYSLFSIVILPINSLINPLLYDS
TLFQYISRPLRGARRTVRDFVSSIGGQTDQTIVTETVSPGSRNIEMSDMTMGGQKKNKDI
PCVETQSVYAYCEE
Download sequence
Identical sequences ML279842a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]