SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML28255a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML28255a-PA
Domain Number 1 Region: 702-877,941-1050
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.02e-16
Family Rhodopsin-like 0.0046
Further Details:      
 
Domain Number 2 Region: 622-654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 654-688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML28255a-PA
Sequence length 1126
Comment pep supercontig:GCA_000226015.1:ML2825:26584:32543:1 gene:ML28255a transcript:ML28255a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVATITRTNFSDSSQFSDDIANAICRSMGYNRSVDWFGMSIVEFDVHSSPEKSFRNKYS
TWYNILVQKEDREIQSLEELIWRLQQRTNSIENITCDERGKDFRNCSFSLQQREAGIAFQ
LVLMCDPKPVHKCAYSDTYFTTNSYYYFTKRCPSDALHYQACRHRGDMVKHVLSYYQSVS
HPICDKTVDKRVTARPDGFNFFITMIHKGKISQTRKMMEFDKKIENYLFASGITTRGECD
GYCGTYWCKDEMFCNGAIYGVNCSITFHFNVTINLTIYHDPTSICDGYFQCIGKKDEIGC
GEYRNPADALFLVDDPLRVALSCQINGVLSTVSKSAICVQSPGLCDNGLDALCVGTSISC
FVHKHLLCNKNSDCLDNSDETVAECQSMTESSCYRRYRQEEKLKIPIAWLGDGIDDCENG
DDERNIWPTCGTGDFTRFVTAERSKNCHEVFLCSPGSPDFVDLDDLCGSNDKCGHLKMCN
REASSKHNVYAIQPWQDINDRHTEAVSYCLKGVAKSLSHYNSPCVEENFNPAQIFGVENL
QSSIILPETLADCKNLFGKTYIYFSCSGRCLGQPKCPLRPPSYDGCTIENNILNRVFTVF
KIGENSHLTFLHKNKISNKYENRNFQCKNDKCIDFQNVCNLVDDCGDGSDEEICSNNFSC
DNPRRFIPRSYQCDGKIDCNDFSDECNVSCGKDIISGLSFIIFSWFVGGAAVILNLTKLF
ENIKVLVTRGYTSALNDKVLTTVLHLGDLFTGTYLLTIAIVNSLVYGSSFCMERFKWISS
DKCASLGVLSTLGAQLSLLALTCLSVFRAIGSDKIHAYTSKYGGIKMFTLALIIVVMSFF
FAYTPLVDRHEDFFVNAMTYTYVKVKIFPSVATKEIHLAKIKLYYKMISISHVKTWKKIN
QLTDEMFSNQYGGLGRRKIHFYGNDGVCLFKYFVTGDDPQKAYVWGCLSWNLLCFLIIFA
CYTKVLMFSKNSKRQLTRRRGRGHDESEEDRRKTQKYVSAVILTDFVCWIPFTIVCVLHS
LEVIDASPLYTVSSIVILPINALINPILYNNFLTSSLKIIFMRGRYWLTRLHTFYVDEIL
SKNNQVSAGRGKNTRQEIELGAMPRQGQSPSIFHPNSLANVRETEF
Download sequence
Identical sequences ML28255a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]