SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML322212a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML322212a-PA
Domain Number 1 Region: 446-613,683-792
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000011
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number 2 Region: 210-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000812
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML322212a-PA
Sequence length 873
Comment pep supercontig:GCA_000226015.1:ML3222:80224:82845:1 gene:ML322212a transcript:ML322212a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIAARFLLFVALVALHARPASPARRGSGKLGEKEERLKEWRNRSTTVSVEEGVKSGANI
LETEVQNDIGVSLTDSTEADVNIVEEVLVEDTVVSGAVEEGRDCSQKSVSKKDKLMCRLS
KNLNESLSDIKVKLKERKKDHEDDHDKKVIMNEKNKKCGSTPSNKRQQQETNEEYYQCSY
LNSRSLAQTCYLSQDLVCDGTSACSDDECGCHGDVFFCSDGKGCVVMEQVCDGHADCLDQ
SDECVCESYLRCETDRVFSKCKRAEMRSEKCAGLIAQLPISLATTSSLSKDSVSLLKCLT
HVRRSAIKKNKIHQRDNFDTKTARKMMRTACKAECQPIDNHCDQVNWNQIEVDRKTRSLS
VNYTCGDGTILSLSQHNEADVCDGYNDCPDSSDETFCLSRFYCTDGTGNLPRSKVCDSVP
DCADLSDECQSCARANLADEKYLISNKYLSYYMVVLCLVVLALNCRGLYRHAARFHYIRR
HSTRVDSVLCLQLSLYDFLMGIYLLILIQKHFQLYGSYCLHDAAWRSSSVCNLSGFIFTS
SSHGSLLTVVIMGAIRCYNCENILSYISLRRLLLGLFLGNVLNLVCNAVVLLPTEYLENI
FVTSLFFHDNRLLKKGTKTLIDEILLEYYGTNTSHQFTGWSSRLSLLSQITSNPDIFVPK
YKFGYFNQSPLCIQNLFSSGPDESLQLLKLLYVCFLGVIILSFSVCYIWIVLVRFKSAVP
SASPSNQRAALRNNRKLSRKVSLIISSQLLAWIPIIIATILSLADREIPPDFYEMAAIVL
IPVNSLLNPLFHSPRHVARRAERGGTRGTVVTQLGTVRRVESRQGQLFQRVCRTPEDREK
ERAEKKEDVKIEDREVVKVEGSICNSLVGIELK
Download sequence
Identical sequences ML322212a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]