SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML32953a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML32953a-PA
Domain Number 1 Region: 772-953,1040-1163
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.93e-20
Family Rhodopsin-like 0.0036
Further Details:      
 
Domain Number 2 Region: 692-726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML32953a-PA
Sequence length 1193
Comment pep supercontig:GCA_000226015.1:ML3295:4269:8658:-1 gene:ML32953a transcript:ML32953a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLKRNTYFLRTLLMWGLVFSAVRKRWRKDGLCGRKYSYPDGTSAAAECDPNGKAPCCS
RKYDGRCGNTTAHCSCDDCSDYRIIYREWEESGGTQRWRGDGMCGSDFPLLDGTPAECNP
DSDIPCCRVQYCSTSTPASGWRCACSNCIDYKAVRELRELGEECGIVRLPTGYLKHMCFD
EESKKVSFKCPYSDVLYKLENNYVTPAPSVSRTCINDPYVYQACGFGAKVTGVGLLCGGY
FCKNSYHAKYDVMKCAGDGCGAEKKDCTTTGDPDIILCDGSCDSTYCNDEMECNGLKYGV
SCKKRNLPHYVQVYGVCDGINGCTDGSDERDCTVTDSTQNTCTQYLVKMVYDRDVRVPIL
NYTRCSIVDLSVKAYPYCVDYSDQTNCSDTTRIGGFCRVNGYMTAVSKSVVCLEFNQEPD
TPIKLCDDQLQKQCVSLADCTIHKHHLCDKRADCLYDSDETLDTCKIMTDVLGFTCHRRF
NRKNGNIPLPISWLMDGIADCMEADDEDPDKWRFCAGVSKQIVAPGTKCQDMFKCPHKDV
YVSLGQLCDGVESCSDGSENSVCRIARDFPIIIKQVPYNGTMRSLCGTNNTSCEVREFST
PWGSNNIFGVNRRTELVVPTSRLYSCKHILGELYVFASCMDLCSEMEVKCPFDYMNTNLK
HDSCPGQFPDRTFTIVDNSFLTFFVKSVSGYYHQEFYQCQNGRCLEYKKVCDLIDDCGDM
SDELNCANHMICEDTRNSTKHQFISLYQKCDGIDDCFDLSDECNSGCGKQILGTQVLKIV
CWFMGILAVIFNSFSMVKGFMSLNDCETEQMMTSTALMSLIGSGDFLIGLYLVILSVYDS
IILGDDFCKHQAEWLTGTTCLILGVISTLGSQVSLFAMTVLSLIRMYGITWNPMRLPKPV
SRKDMVKVISMGGMVIAAAFAVAVTPLIPSLEDNFVQGMYYDPTYRVFVGFPNKARHIKV
LEEYYKQNSTENFTQISTMMSWREIGEKVENMFSQDHGILTKNPVHFYGNDGVCLFKYFV
RTDDARRSRQTFETGEDSAGNLVVWTMLAVNFICFIIITCCYIVIICKTRMSSQSSGQQD
NPKRLKGERAIQNKIMVIIATDFICWVPFIAISALHNLKYIDASSWYAAFAMTVLPLNSV
INPLLYDKAIEEVARRNLKKLKKLLGLDTHNKTVPVDGQVPEITLTERVTAET
Download sequence
Identical sequences ML32953a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]