SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML36936a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML36936a-PA
Domain Number 1 Region: 631-805,874-972
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.87e-16
Family Rhodopsin-like 0.013
Further Details:      
 
Domain Number 2 Region: 556-589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 343-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 4 Region: 588-622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML36936a-PA
Sequence length 1034
Comment pep supercontig:GCA_000226015.1:ML3693:68250:71354:1 gene:ML36936a transcript:ML36936a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFLKLQCAVELGGKHFNVFKCPKEESYYQAVEIADGWGNFDQVYSNSCTEDKFGYQIC
GVIPAISRRQYGEYYLCGYYVCHPGGNFPSDMRIKGKYISGGRLQTSLRCNGKTECTEGE
DEMGCEDLTPDTSYTCLISGTRIPNSKVCNAIYDCPYADDENGSCNHQAGIFCENWTGKL
MWVHPFRICPRFVFDFCTNKEEQKDCDVHEGGRWCKSDSYGNRYIKESQMCFHTQGKEAL
DYKVCIDGRDQLNCTNVALTCSVDGFPTTVSSYGLCQGHHQCQDRFDDLCKTAETDCYIH
KHQFCDGKSDCDYEGDEKAHVCNEVTSNFKCKRRVSTSPTTSLNMPNTWLCDGVIDCLDG
SDEDFTLWNVCGSEDTLIRCVEKSEVCMEMFKCPGAERKFSGIQTLCDNVEECPGENQIC
HESRGIKDVLSVALSFNKTIKILSYQCLPGIKDHGICDQEHLHGSPDKNVYGITPTIIQY
SSSSIGVSCKFFFGELYVFYSCNDLCLDASCPLVSIPYQSCSNIKEKAITFAARQSTIKQ
PHYLTVVHKQKAGFENNLFSCDNRRCVTYDKVCNLADDCGDGSDEVLCVNNYRCNTSAEF
IPLSAVCDGHVDCIDLSDECNDQCQLQILDHTALKVCAWAFGVLATITNLVVVVRKTVSL
SKVRSKTTMFNSIFVICIGVGDLTVGLYLIGVSTADSVYSKSYCTQRFDWLNSGYCTTLG
VLSTAGSTLSLFSMTCLSLFRFHTIRNIFSSRQLSRKSRLSVLSIVVVMVTLVAVIVFIP
ILDIFEDYFLNGIHYGKHVPLFIGAPSKHEHINILEKYYGRLKDSMVTWKMIRNLVMAMF
TNDHGGISGSEQKFYGNSGVCLFKYFVSKSDPQRLFSLAILSLNCMLCLLITISYAFVYL
LSRSSTRATRSVKSSRLERKIGIIIVTDFLAWVPFIVLCFLHYFDLFNGLSLYGIFSIVI
LPLNSVINPLIYDDIYSVMWKWATKKTGLRGVSVSEPRRIKTLTTLKSEFTSKADTNALE
NGSSVVQVNRTTAL
Download sequence
Identical sequences ML36936a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]