SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML41322a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML41322a-PA
Domain Number 1 Region: 1-222
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-66
Family Protein kinases, catalytic subunit 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML41322a-PA
Sequence length 235
Comment pep supercontig:GCA_000226015.1:ML4132:43166:47017:1 gene:ML41322a transcript:ML41322a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMEVCLGGELWTIMRDRGCFDNNTTKFFVACVVEAFDYLHRKGIVYRDLKPENLLLDAE
GYVKLCDFGFGKKIGHGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMFELLTGS
PPFSGADPMQTYNLILRGMDMVEFPRKINKSAQHLVKKLCRDNPAERIGYQRDGLRDIKK
HKWYQGFDWEGLINKRVSPPISPRIKNAIDSSNFDSYPKDNEEAPDEMSGWDADF
Download sequence
Identical sequences ML41322a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]