SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML451314a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML451314a-PA
Domain Number 1 Region: 327-487,574-693
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.87e-19
Family Rhodopsin-like 0.0043
Further Details:      
 
Domain Number 2 Region: 248-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 283-317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML451314a-PA
Sequence length 730
Comment pep supercontig:GCA_000226015.1:ML4513:125430:127622:1 gene:ML451314a transcript:ML451314a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGKLDCEDETDETHPSCLKMTGEKCKRRVGQVEKQPVPHSWIGDGFKDCEDGRDEMNV
WPTCGIGKSLRFVISNETCENVFVCPWDEPGFVELEDLCDGVQTCGNENAVCSRTNGFEP
ISTAVLTTEWGLKKNVAFCMRGLEKIQKFDTMKCSTEISDSFIYPPADVFGIQKTKIILP
SALRLCDHMFGEMYVFTSCLNKCFNSSCPIRNIPRYEACPGQYPNRIGTIVNNSFLIFVT
KSFGDIYTNNYFVCDNNIKCIDYSQVCNLVDDCGDGSDEDTCTNHFKCHSTGKYIPKTRV
CDGNFDCLDLSDECNEQCSSEIIENSALKGFSWLIGFLAIIANGIIITKNSMTLRKCRTT
VALLNKSLIITISFGDLLVGGYLFVISIYDGLIYKQSYCREQISWITSSNCSAIGVLSTL
GSQVSLFAMCVLSVTRIIGICNSMRIPGEVSWLPSVKVTVGMIIMILLSLTIAVIPTVSN
FEDFFVNGVKYAEKLKAFLGTPNKQTILEILEAYYGRMKETILSWKMIDQMVTEMYSHDF
QYPDHTSEKLRVDFYGNDGVCLFKYFVKDEDPQRIFVWLILALNFICFMFITVSYLIIGF
YTYKSSKSLTQSGGNRQISQRNTKINRKISIIITTDFLCWVPFIVVCVLHSAEVLDATPW
YSLFSIVILPINSVLNPLIYDETITSLISKLFRQVRTCFTGTAIHREITLRLTSRRETTV
EIIELESRQI
Download sequence
Identical sequences ML451314a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]