SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ML004439a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML004439a-PA
Domain Number 1 Region: 593-626
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 628-663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML004439a-PA
Sequence length 742
Comment pep supercontig:GCA_000226015.1:ML0044:296329:299144:-1 gene:ML004439a transcript:ML004439a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNELIFFTIATIVQHCTNLDCRIVEVGDKKRYLKEQCGSLFKCPLSDELYSVEPYRDDP
AWNKFSPNCTLKYDKICKNDSKFYQVCGHIESRCNANYGDTNDRDLFCQTYICQHIDRIY
KFSMTFKGKILSGLVNSRYADSNGEYTCLNSQVDERNSPKIEDSYVCKGELETLVGKDKV
CDLKCDCYRCNDESFCNNQTYGIKSCNATFGEHVHAMYMCDGYQQCSNDMDELVCNEEDI
IRNCTPGDVHGPDFYNRFPTNIRPIYSHQICAVPRLGLYAYTCKDGLDQINCTDSERIAF
TCNMNGYPTSLSIFALCMGFELCDDGYQNQCMVAEKGCTIHKSFLCDGVNDCPKGGDESE
IFCATLSNTTCIRTISRDNQPMSFPMSWVKDGKLDCFDGIDENETQWEKCGNDPVTRYDE
EGTDCHDVFLCSTGGIESLVIDGFVELQDLCDRVESCGMEDKICASARNSPEIYNQITYF
DPIGPLKLMHCLDGLRNLRFQKCPCREITFKGPHKDILGVSALTIVGPLDKESCANTFGE
LYVYLSCSSSCSDTTCPLKPVGPDDCTNVENQVLSISLDYQLTIVQKRKGSYYSPYFPCK
NHKCVTFSKVCDLKNDCGDNSDEENCSNNFYCNTSGEFIPKTSICDGKFDCRDYSDECGE
VCSGQSKRLIPNKYFAAFSWTSGILALLLNAFTMTTTLLSIKRYESVKISCDEIRSTVWI
FSGSSILELHLLRHNNYLLLRY
Download sequence
Identical sequences ML004439a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]