SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ML00541a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML00541a-PA
Domain Number 1 Region: 347-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 274-307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML00541a-PA
Sequence length 433
Comment pep supercontig:GCA_000226015.1:ML0054:1665:5609:-1 gene:ML00541a transcript:ML00541a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAWLLFSLICLNLCNDLVISAAISGVNPGETPEEDSALNNATPDGESTKSSNTTFPT
KTSPPAAITTLNSTTGIASSTNSSLTTTDRPISTTGRPISTTGKPSSTTGRPSSTTRSSS
TTPKTSSTTRSSSTTPKTSSTSSSSTTTAKTSSTSSSSTTTPKTSSTSSSSTTTPKTSST
SSSSTTTPKTSSTSSSSTSTGRTISTSSSSTTTAKTSSTSSSSTTTPKTSSTSSTSTGSS
GSTSKTLSTTYPSSSSYSSSVTPTEEPDRCATVGKIPCLGYPQICIPETWLCDFEEDCPY
GTDESNCDGESDDGLDGGKSKPGGGKVFIVDPAQPTNRPFEPNCRWQGGMACPSETGRCV
PQNRICDGILDCSDGEDETGQSCLHKQVASLEKGVAKLGVKVAVFLLQTKEAVSVSIKSI
YCKLLNSEACKNL
Download sequence
Identical sequences ML00541a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]