SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML015416a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML015416a-PA
Domain Number 1 Region: 218-494
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-78
Family Protein kinases, catalytic subunit 0.000000223
Further Details:      
 
Domain Number 2 Region: 114-256
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-37
Family SH2 domain 0.0000573
Further Details:      
 
Domain Number 3 Region: 42-165
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-23
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML015416a-PA
Sequence length 514
Comment pep supercontig:GCA_000226015.1:ML0154:109281:130814:-1 gene:ML015416a transcript:ML015416a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGACFSKQRNKPTQDEVTRQDNFHHVGPSSSNFPNAYTPQPQPVNHAKETTQRPIYIALY
DYEARTEDDLPFRKGEKLEVQDMSEGDWWHVKSLLTGNLGYVPSNYLADARGIHSEDWYR
GNIKRADAERELLYKGQNCNGLFLIRESESKPGDYSLSIRDEDSVKHYRIRRWDDGRFYI
AKRQMFPTLKALVEHYKENQDGLVRKLATPCTRTEKPFNDLSRQVRDHWEIDRAQITFTE
KLGTGHFATVHKGLWKNSVAVAVKMLKTGGTDQKMTKEEFIEEANVMKELRHNKLVQLFA
VCTMEEPFLIITEYMCNGSLHNYLQKPEGRHLRLPQLIQMSAEIAQGMAYIEKMNYIHRD
LAARNVLVGEHNTVKICDFGLARFVYGQDQRNSANYKEEKPFPIKWTAPEAIQMPYNFSI
KSDVWSFGILLTEIITYGKTPYPGMSNHEVTTAITKNRYRMKQPPMCPEELYIIMRDCWK
ENPQDRPTFESLCWRLEEYFNLSGSEYRDIQTPR
Download sequence
Identical sequences ML015416a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]