SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML016352a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML016352a-PA
Domain Number 1 Region: 695-869,954-1072
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000137
Family Rhodopsin-like 0.0066
Further Details:      
 
Domain Number 2 Region: 614-648
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 347-384
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000903
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML016352a-PA
Sequence length 1110
Comment pep supercontig:GCA_000226015.1:ML0163:409522:415356:1 gene:ML016352a transcript:ML016352a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWAATQGIRSNEGMIYFILMVKFMVAVSKARVDSISEGAEKCGATLPFLNDSTRTCDLS
TTRCCNAVEERCDDEDPDCICNGCVDNELFRNLEDSGDSCVVSVVNGFLKNVCHDKESSS
LYFKCIESDQTYEFRIIDRNRVEFSKKCESDSKSYQACGFTQGVVTNKADSACGWWVCPD
RNSNYIAKNYPCDGDPVPIGCDGKCDISTCVDESSCNGRKYGITCKGTWGKTVDLPVEKI
CDGSADCDDKRDENDCEIEDFSTLQSCPHIGNKNETVPIHNYTRCAVLDLNRDPPVLPYC
VNLHDQTNCSDSSRLGGQCKVGGFLTNVSESAVCSGLDLCDDGSHNLCNDVSIYCQNIHK
HKFCDGVEDCLDGSDEANDVCAFMTKNLECTRFFGNQEKRSIPRSWIQDNFTDCLDGIDE
TVSSNFCNVGGEGEDDIGYFRAEDETCENVFLCPKADSADGSNFVKFDVLCDTKESCSGA
ENEVCAVSRDFPRKNTTVPFAENTEGFVKELCNQSDSESNCAIRQFPYPVSEVFGVDKIK
LNVANNVVDCSNKFGEYYVYYSCMGLCESANSTCPLKNEMLNHDSCPRQYSDRVLTLADS
SHLTFVTKSAKRGYHSDIFQCDNGRCVNYSQVCDLVNDCEDMSDEMNCNNHFICESSLEK
EVMQLIGNQQKCDGIYDCLDLSDECNGDCTRRIIHSDTSLTPFCWVIGTLSTLLNICALS
IVPTALRRCRNENVLFSKSLVMLIFIGDLMMGIYLIALSVYDDIIYKEDFCKMQADWFTG
TECKALGIISTIGSQLSLFAMTALSVFRLFKVLTNGLPLPVIRRSVVRSVTCTVLISVLS
VAVAIIPLIPFLDDHFVQGMFYDPDYQVFVGLNTKIKHINILKKYYPKENLSVDISWEEI
SKLVDGMFSRNYGILDRHQVHFYGNDGSCMFKYIVPTNDARRERGGSFKTELNNDPVVWV
MLTINLICFVVILFSAIVICQKSRRSTSKAGQTTNKVARKRNRNLELRILAIVVTDFLCW
VPFIIICYLHNQGIVDASTWYQALALVVLPINSLINPMIYDRTITRFCKRRLNSWTSQAA
VVHENIAATSQAANDTGNAKEVEMQFLKEL
Download sequence
Identical sequences ML016352a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]