SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML019111a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML019111a-PA
Domain Number 1 Region: 351-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000175
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 58-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 232-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 265-308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 307-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 147-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 7 Region: 186-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 109-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML019111a-PA
Sequence length 483
Comment pep supercontig:GCA_000226015.1:ML0191:65502:78888:-1 gene:ML019111a transcript:ML019111a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVRLPGELGTSGSLLLYAIGGKRTRRESRISPEGSPDCYHQAFICDGSVDCVDTGKDEL
DCETHTCAEDEFQCHLGNCIPSAKQCDHVPDCFDNSDEQDCVWKCDELREFKCARTGKCI
TLEQRCDGTLNCGGFDDSDEMECGRPCTDGLLCDSGTRCISSAQICDQQPDCRDGSDENP
SKCLSYCDPPKWACGGQGYGYCINAEDICDGHVDCQDQSDEINCGENTPCRGGLRCGDGV
CVPLEWKCDRHADCSDGSDELNCDVCEATEFKCTNNTCIKKDLVCNGVSDCSSDNDETHC
LKEGETCERGFLCNSSRKCIPKRLLCDQTDDCGDSSDEIPGCLPWDSCSEDNDECAGSEL
ACSQFCTNTNGSYFCSCDSGYRLETNSRSCAPTDEVEPYIVFSNILEMRKTDLNGTRMSI
LFETTYSNIIDYDYRKEMWYWVSTESHRVSGARYKVLSYTGVICTCCKRAKFARTKRFKW
LKL
Download sequence
Identical sequences ML019111a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]