SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML02274a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML02274a-PA
Domain Number 1 Region: 1880-1964,2231-2292
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-20
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 1169-1416
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000131
Family YWTD domain 0.002
Further Details:      
 
Domain Number 3 Region: 2010-2195
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000981
Family YWTD domain 0.0047
Further Details:      
 
Domain Number 4 Region: 786-826
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 986-1021
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 384-607
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000353
Family YWTD domain 0.0036
Further Details:      
 
Domain Number 7 Region: 1023-1058
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 1062-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.028
Further Details:      
 
Domain Number 9 Region: 1555-1592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 24-185
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000353
Family YWTD domain 0.0088
Further Details:      
 
Domain Number 11 Region: 1474-1505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 12 Region: 261-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 13 Region: 713-748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 873-909
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 15 Region: 911-947
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 16 Region: 1754-1790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 1508-1547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 18 Region: 755-787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 19 Region: 1097-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000587
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 299-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 21 Region: 948-982
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML02274a-PA
Sequence length 2389
Comment pep supercontig:GCA_000226015.1:ML0227:13158:46820:-1 gene:ML02274a transcript:ML02274a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIPQTGVSRTEYIYKIDKVTVTRGFLFLTDSLNQTVYISKLGSYVKPVIQFDKRLYTI
LDIQLDIVKMWIFVSVKVGSVTEIYQFQYNGVNTRKQGDAITHIPSTNSHFTVDDLNGRL
YLLDKYESYVHVLSYNKTHVESLAPVSLNADVRCSSISVYKDRLYITGNKIAGILVLDLT
SNTETIVSPQLGHLRQCSFKNIIMLPPPPHLMFWDKTPNKSCSKVVVEAQKKTVNDNVLM
FTRVLPFLLFTVNIPVVMGGDCNVTDISCDNGKCLDRSFLCDGVVHCKDKSDEMDCQNAT
CPQDTCIPKDWICDGSSDCTNGKDELNCPEESNSNTTCKNCTCESNTECSQRCVSGFCVC
SEGYTMSTEDDKTCNVDTAATVYFTSNSKLYSAQVGNSVVSALTPLTFEHSPDITAFDVL
ADTGLIIAASRGEILSIQLPETGAHLVRTLIKRQNAITSIAVDWGNDNVYWVEDDTLMLS
NTRYTGLKTLSKEVRAVTLDIVNSDLYYTTTRGDVVKCRVDARNCVTLIQSQNVSLIYLD
QVSRNIFYLTQNSSLYTQDSTGQTHLLTATLSEDPVTHIAYFESSLYYMTNSGLMSYNKL
TGEKRAVTLQLSNGTPVSPAKMVLSHASLQPATNALCADASCSHICTQTAPGATSCLCSD
DFTLSDGTCIYTGEQCDALMRCDDGNCMLDESQRCDGFRDCYDGSDEKHCDTDCRDTEFK
CAVGGCIHGTLRCDASQDCVDGSDELNCSGLCEAGFLCSSGHCINRKLECNLHPDCPDGS
DEAVELCGHTPCATGTFQCAPNNCIPLSWTCDGYSDCANGTDEENCSEDQCVVRCDERES
GEARCLPATARCNGISECNDGTDEAKCESGPESCKEWEFTCQDGTGCISFLLRCDGVSQC
QDGSDELLCDKCKEGYTRCDNGKCVNPRYKCDGVRHCPLGEDELNCSRCEENQIACDNGC
LPDFLRCDGEQDCSDGKDEMDCISDHCAQDQFPCKSGACVDKHYRCDGSPDCADNSDEEN
CSVCPPSHFLCHTGRCISQNAVCNDIDDCGDRSDEQDCQDEPVNECLTRPCDLEHGQCVD
LRLGYYCSCDPGYQLARNKKYCVDVDECDLRAHARVCTQECYNTVGGYACGCADGFSLDR
RDKVTCYPDTPLSFLLLSHHTVYLLSHDSYLDPTTHLVLYDLPDTVHHIAAHFTVNSNYV
YTAEGTSIQRYIFDNDTTLDSTWSKLQNVHVSSLALDWSTGNLYWSDPVLGQINLVSPSQ
RQVTLISAHCEKVRSLVLLPARGKMYFIHVHQGIAQIAETGMDGTRRRTLTALGETISHF
DIDVVTTTLYYVSSYCPGQVNSCIYKLELKYPTSTPQLLQTGLLPVSGFRAFSPHIYLTT
ASSGVQQCKLLSPTSCTQLTSNQTRYTDILIASPLSQPPLQNACGGETCGEGAVCVITAV
DSLGTQVQSTCICESGVYKDGECKAVETRCEGGLYFPCSGGGCIETRFRCDGIQDCTDGT
DEVGCDVYTCNSLLQFSCYHGNQCVPIGRVCDNIPDCQDKSDEMRCTGTNSTGTTLCSDT
EFQCTSTSTCVPAVYKCDGTPDCLLGEDEEGCGRLECSGIQCTDNNSRQKCYPDSVQWDG
KTDCYYGVDEGGERVCTGDTYQCGSLCYPTQWLCDGVQDCSTDQECQPKCQSGHVPLWSG
TTGRCVSQSLVCDGWKDLESGADEAGCENVGCEQGFLFCDGMCVPSQSDWLCGGYCGPAL
RSFQHKVWQRDGCPCSASERQCADGKCVPRSFWCDKEADCNDEEDEVWCPGSDCSPPDFC
CSYSGRILRESVGLCDGADDCLDGSDELLCPVTRQPECAPGAYDCKTDQDLETRCITEPQ
CNNSTAHQTSMCRNSRDVMRCNHGNPCDDGNGGCSHVCNALPDNTRQCSCFLGYYLASDG
RTCKDINECEDATTCSQVCTNLKGSYTCSCVAGFIKSGSDGSSCKQESGPTRVVISTQFD
VRLSTPATLTKLTPRARAGYKFSFYAPVDESLYYSVLLVNTHTLYRRSTAGDVEVNKEEF
VAELKGEVRDIQYNPLTHNIVYCNSHSLYLLSLNHTLSRTLFTDPIYPLQKLALSPQTGL
IFFIRNWMLGVMSSDGSNKRYLATANNDLRTFQFKDGRATSLSVDEPAKRVYWYDPDLQQ
LSSVSYTGSHIKTVMSRLKQVQEIMVWGDHVFYHTGKELWSVEKRGLGTPVKMESVLPRA
SHISVARDKPDVLAGCAKCPGICIVTQGVGPTCTAHHDNSTCTCKNGGQCIVLNGSVVCD
CRSGYHGNLCQSPRSSSSELLVYLLVGAALFSLLIFLLFLCYRCKDKYWISRLTNIAHVR
YSRHNTSIVTNNSNLPYGQFNEGCEEYDLEEITTDQSQLMEKEEEEDVI
Download sequence
Identical sequences ML02274a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]