SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML025011a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML025011a-PA
Domain Number 1 Region: 32-362
Classification Level Classification E-value
Superfamily Sema domain 1.18e-22
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 502-600
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 420-515
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000144
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 365-406
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000471
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML025011a-PA
Sequence length 918
Comment pep supercontig:GCA_000226015.1:ML0250:111519:140847:1 gene:ML025011a transcript:ML025011a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKVVKYLTTLSDCPKCVVYTTETNFSSMISFESKVLIGARNSIFEIDFSEEISTKHEDR
TNRDKSLQYEPAGLDSCKRLGQQVEDCQNYYKVMLRLNQADLFICGTSAFSPVCGVRTIS
DLSYSAHSNDGLGICPANPRSSTSYIKLKDSPFGFAGTERASSSEYAISLINLGYGSYDV
LAKTKSDNHWLNNYCKMFSIFRTRVCLLLRVRGPRVLRAARDCCRSYEYREYNKPCCPGS
FRDEAEAKPFTCLDGRTAQDASRNQLMSSVITSSDPVFYSAVQMKKLVIQSVNIGKETSI
IANTATNGGKLIRIGFKENYGGTVRHRILKMQRTGPVVELSAPDGDSSQVYLMSNDWVGY
APLKMDCSHYTTCQSCQSAFPYCGWCSSRSDDERLCTSTSECGEERTWRSPYENCPPLAR
FRVQPEDRTVTLTESDPVAEVELRCESEGAAKPSWSRESSQIASTATISDDQTTLRLRVV
SYMDAGTYVCSLKGEAGNVNAEAELTVLVSPSVPRVSPWNASVSRGDDVTLTCLSEGHPK
PTVMWKLKNGSPLPESARVDQTSGELKLIRIVPADAGRYYCEVSNNVGNPRISQEIDVTV
SDINLKDPDSDATIDVNKPFDIKKIIIIVCCVVILIIAVAAIVHFVLKKRKRTKQDVQAM
FPLTYQEQIYGDMPNTPNTVMTPHFIEEQNPAFRGYVHKRPLLVATRGRDSGLKMQFDWN
QAQQLMGQQLLTQQLMGQIGPAMPYLVPSRDVAEDEPPPAYQAEIELHQPPTQGRRAPPA
EHFFTPVQRVESPGYSGSLDSHPGQTAGLSEPGYSIASIEPLPGGPRGPTPPPRTDIRPP
VSAGVELDTEVENRASSSPDPSSTSPHSHHPSDLPPQTADTESIHEYERIGLLNNAVQVS
VLGDQDNASSRGSSLLQT
Download sequence
Identical sequences ML025011a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]