SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML030242a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML030242a-PA
Domain Number 1 Region: 6-72,108-136
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.02e-21
Family alpha-D-mannose-specific plant lectins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML030242a-PA
Sequence length 150
Comment pep supercontig:GCA_000226015.1:ML0302:436442:437494:1 gene:ML030242a transcript:ML030242a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRRQVPGSNKLSVQVDGNLMLVDDKTKQAVWESRTSRSSSFYQLIAQDDNNLVLYDENR
RLIWATETVNQCKEIPKEGGCSQDRCVVLAGGEDVVLAPDERIVSPNGEVTLLMQTDGNL
VLYCRGGFPVWHSDTWFWQTEDHRLVIKVR
Download sequence
Identical sequences ML030242a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]