SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML03243a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML03243a-PA
Domain Number 1 Region: 455-763
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.71e-105
Family PDEase 0.0000000877
Further Details:      
 
Domain Number 2 Region: 189-379
Classification Level Classification E-value
Superfamily GAF domain-like 7.66e-42
Family GAF domain 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML03243a-PA
Sequence length 833
Comment pep supercontig:GCA_000226015.1:ML0324:50621:86949:1 gene:ML03243a transcript:ML03243a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSFIKKLGSCVVRMPLSEPNVERYLDEHPGFLQKYVVTHLSETDLKDLYEHWYKAHGRK
SSTEKERKRSRTEEEGKSCHAVEHKTSIVDNQLVVPPAGKATLETPTPEEAMDVVPSVAP
GKQLHQFPNRQFRKTVSREGAPILKPYRRSFSDDLINIRSLLPTNLQLPGEPGEEPSARR
RSREEWRQLNEPDLMMELVRDIAQDLDLVSLCFKILLNVGILTNGDRCSLFLIFGSGDQR
FLVSKLFDVTENSQLTDMYEHKPIRIPYGKGIVGYVAESGETVNIPDAYQDERFNKAIDM
QTGFRTKSILCMPVKNNQSEIVGVAQVINKKDEEGPFTANDEKIFERYLTFCGIGITNAL
LFQSSVIMYKRSDSLVLLAHYIFEEQRDMNNLLRRVLKKGCEMFSSTGCRILLRESPESD
GLTTVEPDNILSYHASANKDEVSLIEREEIPSADSLNILSFEFADHSLDTDQTVLATIRM
FMDLDLINKFRIDFQSLIRWSITVRKNYRDVMYHNWRHGFNVAQMMFAMLTSGQMSQQFT
DLEVFALLVGSLCHDIDHRGTTNQFQKLSDSPLANLYSTSFMEYHHFNHFLTISQVEGNN
IFKSLNEKEYADFLDLTKTTILATDLALYFKHKALFKQLVENPSTNWDDGENRVLLRSMM
ITGCDLSAITKPWEVQRMVAEKIASEFFNQGDIERDKFGHTPAYMMDRSKRDELPKMQVG
FIDNICLELYESLEKANPLFRPLLDGCLSNRRNWSNLCERRTSFADISSANITLTSINTN
RPRDSSFSDEISDSDSERGESLKTPTPDIAEPGRAFTVGTLSNQPEEESGVEG
Download sequence
Identical sequences ML03243a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]