SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML03452a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML03452a-PA
Domain Number 1 Region: 386-461,511-599
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-27
Family RUN domain 0.0024
Further Details:      
 
Domain Number 2 Region: 609-702
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.11e-17
Family Lipoxigenase N-terminal domain 0.083
Further Details:      
 
Domain Number 3 Region: 752-818,854-917
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000942
Family RUN domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML03452a-PA
Sequence length 928
Comment pep supercontig:GCA_000226015.1:ML0345:35061:42614:1 gene:ML03452a transcript:ML03452a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVAESLKCLIYPFEWDHVYVPIVPATSLDLIEAPVTYIMGLSANLSLEEQADICVLDID
NNRLTLPEDIPNLPYRDELVHAITSILVRPNSSQPSDPFSRLKLTTNFSSGDSSTQKNCG
SSTFGQRRLNRPPKLKLIRQCNAELKDSPTNEEKSQHSSVINLTIRNLFLDHLCKMLQNY
DKFVIYPLDRKTWDANRDNLDNFERDVFLCDQAEQNLTFLSRFLETHMFSSFVDSKILCS
FNVASEAIAHFDSRIEELRKTAVDEVIKSPPGVEVRKPTGSAKTPSLSTGLVDIVCRPPI
QCSSTIPIGETTPTSDFPILRSQLLLEHASDKTSASMSRKLLRQRSIKEAKAKLEHNSNS
LTSPTVKKHFPLDTDDSFDRMMKAHADFTNQLLKDCKNKINRLLVLKMGPEAQGLGYDYV
IRGVEENSMVGAICDLVERVWSHGLVIRDGKSALWNQLRRHLDRWKEKHPQCSPSSTGST
SEDDSLEDNYRTSGVFFRRSSQQTPNLPPEISTNEQLYIDINSIKNLRIIRTDTGRARAF
IRLLIEKQCLQQYLELITSDLEVLSKRYKDYAFLRDEEKVAPFIKYLLTLSAVPFTCFTA
SFPNITIQYKLYIVNSNKFNAQSTANAWVLLTGEKGDTGVYGLPRGESIVSLMTRNLGEL
RSLRVGHDNSGLSPGWCLDHILVENVLNGHCTLFRCGGWLSRSSRDGSIERLLIGERMDR
NEYRNLRNTSQKDRSPPRFPSSLRVDGTVKAQEMLATAVNSLVRHRYRSQESDGTLVALL
CGPQGLVPALQGLLSAGLRPTSRFNRGTPLVWEFVHKVYLEVSEVNTCHPDQPAIQSFVK
CVQLLMRPSCSSVGLDGKFQTLICLGVRDGVLHRWFYMMSQSLAASKCYDNTGIFKQDSM
LGEIMGLLKILEDLSIPVDVSLIHQTER
Download sequence
Identical sequences ML03452a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]