SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML064944a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML064944a-PA
Domain Number 1 Region: 206-373
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-40
Family Dual specificity phosphatase-like 0.0000292
Further Details:      
 
Domain Number 2 Region: 386-519
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.25e-18
Family PLC-like (P variant) 0.0033
Further Details:      
 
Domain Number 3 Region: 76-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000432
Family Voltage-gated potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML064944a-PA
Sequence length 526
Comment pep supercontig:GCA_000226015.1:ML0649:418445:420025:1 gene:ML064944a transcript:ML064944a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRENNELYQNSAAAKVTHSRKHGASFVSLDIDHTQPDGTASTESVDHIVDGHETSLTRA
QFKVRLVVEHISVQIISVLLIFIDFCLAVAALISDDDVFDKRTLIISNVILGYFIFEICL
RVFGIGPKTFSKTVWEMLDAFVIMVSLIVALTVRGGTGSDAARFTTVGRAFRIIRLFRLI
PQCRRCVLSARLTTSENKRRYREGGYDLDLTYITEKVIAMSFPSSGWLALYRNPIEEVAK
FFKTKHQGHFKVYNLCSERDYEYQHFDYSVQRYMIDDHNVPTLHQMLDFVRDAQRFIKRG
EDNVIAVHCKGGKGRTGSMICAYLMYTNKSQFRTGESAREYFASRRSDLRVSAKFQGVQT
PSQCRFIDYWQEIIHNYDCVIPEAPSLFIKSLKVHSPPEPIQGTSSDLLVEVWDRSNVIT
SFSLTSCSSICNVTYQEDTLSIDFLDHAKPCVTGDIKVRLKSTKLPIKYDKASFYLWFNT
IFVRGGELFVEREMLDNPHFTKYNKVYSESFGVTVLFDQKQQQRLI
Download sequence
Identical sequences ML064944a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]