SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML08213a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML08213a-PA
Domain Number 1 Region: 954-1076,1140-1262
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000201
Family Rhodopsin-like 0.0047
Further Details:      
 
Domain Number 2 Region: 817-855
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML08213a-PA
Sequence length 1325
Comment pep supercontig:GCA_000226015.1:ML0821:43256:57705:1 gene:ML08213a transcript:ML08213a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSIGHGGLRRTFRRSRSDPLESAKKNVSAEHFSDPNRSAGFIPVNWVDLAVFVWNNLF
LRAQASSSQGNIHGLGSERSCFRLIRLIRRLQSHTSAVSHKCNCEQAGIVATENLTDKAA
DLICRDMGFSHAVDWVDILYLPIMSDYYGIKSLDLIKFAPEKLGYSVTHINFSDIYCGDE
AVSFDRDCSYNVTKISRNTTAAYFHSFVILSCNPRPGQCRETISYVHTVRISCWRGPIFS
LEKCGTKSEAYYTRLFSIRPGDGLLDVLDKPEANPYNLISFFVSKVCRNDTEHQYQKCGT
VIQSVNGISINNCEALSCYTVISKAMGHKWLEIVLQNWICDRIYKGEHISEILSCEEDLQ
NHCANISFINKPVTKCDHLCDRTDCLDEQFCNGLNYGIKCKRGNNNVVIQPGKICDGMSD
CDYGNDEHGCKRYNTYVCIKSSLDLNINYFGGCHDSHSQEHIPLFNFTRCAALQRLPMRC
SVNDEGRSDVISRASHFSTLCSNGLDQTNCTDDTLVALTCPINGYDTTVSKIAICPAKDI
AVFDNICDNNFDNECVFPSHECVIHKHQLCDNIVDCTDMSDEKECTEMTEKTCARRYKHE
TPLHIPLTWLNDGLSDCEDGLDEVSQGPVFMSPTCKVGTQFRFLPKGHFCENVFLCGIAS
ENFVKLENICNGMNVCQEEYRACKKSRPFKTVISKAIMSKKDSDSDTKHFSYCLPGVHTS
VGQQISLCLQEMFQFPESGIIGVIPVPVMLPEERQNCKNFFGEQYVIMACKKRCENTSCP
LKVLQPDACHQTKKYRSLSITRSFSKLTFAYYDNFNFYHLKSDVFQCKNDLCLSYDKVCN
LVDDCGDQSDEANCTSSFHCQNSKEYIPYSEKCNGKVQCNDYMDECNEQCRRVIISGLGF
KTVCWIMGFTAVVLNVAKTVENVHFILSGRQPNQKTDTVLGLLINIGDFLTGAYLFSIAV
VDTIVYGKGYCKQQYLWLSSDTCSFLGVISTVGTQLSLFSMTLLSLSRLCEVLKFKIHTK
KYFFLKMMIIVVVVTVISVGMAIIPLISSYEDLFVNGMTYNPKIKLFLPYVDKKTHLDIL
QGFFGRIRIGVITWKDINRLVNEMFTHDYENGTLNKRKIHFYGNNGVCLFKFFVNESDPQ
KAFVWSCLGVNLFCFFVISLCYGIINLKYEYSNENVDQVEENLSNEVLQEKKEFQRNIAV
IIITDFICWVPFIFICFLHSLDLIDATPSYPIFSLVILPINSVINPLMYGDSLSKKMKRL
KRRVQLNMLSGTMAVVHNVEHIEMGVIENRAVQEAGQLIRDTNPEQINIPTIEITPASLC
EEKFS
Download sequence
Identical sequences ML08213a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]