SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML106613a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML106613a-PA
Domain Number 1 Region: 124-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 2 Region: 164-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000445
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML106613a-PA
Sequence length 268
Comment pep supercontig:GCA_000226015.1:ML1066:97792:109579:-1 gene:ML106613a transcript:ML106613a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYDVAYKSSVDESIFCIGEKRRISSPGSGDSGGPVWVYANDVPKLIKHIDWNFGRSENG
CKYSRIKMNEYTILPSDSAPELYSGRKFETTEVKLSIFGTRTPNQLQSLKFTYQVYNETF
ETVTCKGPEYKCDGVMDCMDQEDESDCEYNSTIAKEVFNIFTIGCFPFDYKCKDSTKCVR
PSRVGDFSRDCPSMDDEWRVGVESKDVKIEADSKLGRDINGEKRKKIDVAHLLNYTTDFF
SGTRGVRSSYCLGVFYVGVMFLVRVLQM
Download sequence
Identical sequences ML106613a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]