SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML149618a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML149618a-PA
Domain Number 1 Region: 920-1231
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000513
Family Rhodopsin-like 0.0059
Further Details:      
 
Domain Number 2 Region: 22-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 233-275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 149-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 197-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 7 Region: 836-873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML149618a-PA
Sequence length 1403
Comment pep supercontig:GCA_000226015.1:ML1496:120334:131058:-1 gene:ML149618a transcript:ML149618a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVIVCTFLAIRVRSRIEFEITTCKKDEVKCADSSQCIPKTYMCDGWSDCDGDTDELQSV
CKGYECDEGRTKCADKKLCYSESNVCDGDFDCLDGSDEESCGDYICGEGRVKCADNLQCI
PMSSKCDHGHDETETLVFDCKDESDEDASSCKAFECDDGRKKCANDVQCIPLESWCDGFD
DCEDKSDETNTTCIDYDCGTGKVKCPKSSQCIPSINLCDGAIHCNDKSDEGTAFCKKYEC
GEKRRKCSNGVQCILEEYVCDGMYDCFDASDEISSECYAEEDCSIQELGGFLKYMCPYKN
NQSFQYKCHNSDMFYILDNEKIPLRGDVCSGDPYFYQACDKRLSGYKITNSTPALCNNYL
CQNKNDKNESIILTLTRLREVGYICNGVNDCLDATNTTLKLDESKCRAEDKTRLLSGVEV
ETSKVCDDECDSENCEDEAVCNNFTYGLYCEYPAFRNNSALAYVPPRRICDETWDCKDYD
DERDDCYQETLKNDTCIHHRQKKITAPVYNYTRCGVLGFYNIYCQDKDLKKYQTNCTDSS
RVGLTCEIDGYRSTVSKYLICHGKSVNICDDKIEIQCPVLSKSCVQHRHLMCDNVTDCDD
GSDENHQICLDQTEKKCQRRVGKRGNLTLPLAWINDGVVDCESGEDEKAVWPTCGDGQTF
RFVSSSDKPCENVFKCLWGSPGYVELDDLCDGRETCGNENKICSLSRSHKAISSSVWSSS
KSGQVKHLSFCIKGLHSINRMENYSCVRENFKFPNYQTFGVETITELILPNTSKNCDNLF
GEQYIFNSCTGKCQNSSCPLKTIPKYEFCPSQYSKRVGTIANNEFLVFLISQQNVYNNRF
FVCGNKTKSKCIDYSQVCDLVDDCGDESDEQFCTNHFQCHDLDPTNNKSMLIPVTKKCDG
KFDCFDLSDECNEQCSRQILEPFYVRALSWFMGLLATIANCTVVIKSLYNVRNSKNSIVL
INKCMVILISSGEFFVGCYLCSIAAYDSIVFKGGYCKQQIEWITSVECSVLGVISTIGFQ
ITLFSMTVLSFVRLYIISKSTKIPDKIIHRNSEKEQILPVIEAYYGRKKSAILSWEMILK
MVAEMFSHDRGSYDYMDESNLKKVHFYGSDGVCLFKYFVGNEDPQKSFVWNILVINSICF
LFIWMSYLTIAMISYKSTKNLSDVKGNKQMSIRNNKMNRRISSIIAANFVCWVPFLVVCI
LHSFNIVDATRWYSLFSMIILPLKSVINPIACDDTITKLVTMPVKKLLVFMTNSAAILSL
QKKSSFVQDTGKNLELVGSVESGEKDAAINHDGKHEQSSPTGVRSELNQTTSKKLIAIAR
EKADRVDPEHPRHMAQCPDTPVVRRTSRQSWRKKSAEILAPLPYSKLPKQLIRRPGKASE
LTQQYHQLSETATKFPNRTSKNH
Download sequence
Identical sequences ML149618a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]