SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML149625a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML149625a-PA
Domain Number 1 Region: 192-262,638-653,697-732
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000227
Family I set domains 0.058
Further Details:      
 
Domain Number 2 Region: 734-831
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000502
Family I set domains 0.07
Further Details:      
 
Domain Number 3 Region: 6-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000293
Family I set domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML149625a-PA
Sequence length 1480
Comment pep supercontig:GCA_000226015.1:ML1496:183774:193667:-1 gene:ML149625a transcript:ML149625a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAEREYVMAAEGDDRELLCTAYSKDPVSIFWRKTVEGVEQNITGDSYPVKNTPEFVSQS
ILKLTNLSESDTSNSIECWFMPGNGEKKFDTITLDVIELRTIGREVTRGLSAELTCSATP
RQSRIEDLRFKWYRIDELGREEEKNETRSETGKSMLKISSANDTSFTCLVYSEPFGIASN
ATRSLSYNVFDITSPRDVTVTAGDNVTLTCKVTENTGTPHFSWYKESDNTNVLFESSGSS
NGSTSEYTFKTDSFELTGNYFCNVSIYYDGETNGPFKSNTSCVIVREFQSSFKNLTLVHE
HEGRRKIQELQCVYRGDLPAVDFVEWRTPSGRFSEGDYAEFIQVSKYENTKTTQVNNNKS
DENTYKTVLTYSRTVKSNEEFFCDFHMKNGDVMSKYTRVSVFNYTELPKYTYNPTEISFT
YVSEVSSNVTWLINNEVYDSVKHTAFTPGHHVIEPRSSIKFNLTVDMSKLDEGADPVEVK
GIIKFDIEENEGIVTQPYPDKQVNTIVYKRDFVEELESYLPVPQNVTDKTFTCLVAGDSN
NVNFSWFIGSIELLEEIENIEITQLEADPVGSDKRLKSTLTVRDITKSPLYNNELKCKAT
WEDPEMFSVESVADLDTYGASIEPRSYTKADGSAVLTCLVWGNVPPKSVFWMDKSGDVVE
KDENRTTGGESKKPVNTSSSNFDVDTRQFNDASNTQESTLTITNVDVSASGNYECVWKTD
SLNVTATMDLAVRMLKAKDDVLYSTDGAIYLECQYEGTEEGTMAWFYKSQPLNDEDESIT
IETGKFNDTSNLQTFKLEISEVSLKENSGVYTCSLSFPDGDVVTGTTRVVVRESVILSDY
SWTTDDDVTTPLVYAEDGVSKMQCQLDADKVPSDVEWSFNGNKIQFDGVRKIMVNSVLSG
TTGGLRYFSNVTLKGDENVVDGRYTCKFTFFDKQTSGQERTISTSTHVTILKVDVAANKK
CTFVDYQKERDASLGCTFEGDIESVNVGLRTSIVYLPNGKARSLDVSESLQYSVVNVTNK
DDGVYKCTFETDSKGASGYPIFSASQRLISRKAMISSSSTKVLAGFTMTLSCNIPGGAKS
ISWYSLESPWIGFDGQRRRAITIGPLESSYLNNEFVCSVDYTDSDRYNFFGGEIRSSPTT
LKISNIKSFTTDSNEVIEGQTFNLTCTAEGETKPEFTVSNDMRSLDKSRYSMITESIESK
SDSTVHVAKYQIQSNFATVIQGGQDFYCSVDFGSNSPERMEKLKITTYYNCSNAKISVLG
KAPATQSIDYEDGQDGNRNATVTCPADTNNTRYSIYESTQAKGKAVCKKDKGYYEPSYLA
ICLASRAFENGRFEQIWNLKDTTDTYCTDSSTGEYSKTEMTETLTTSNRQCGPYPIVPCL
NLKDSECTLDVEKTGCRWDESDSANKRLHVFYQVNFNKPVWTIQERKDLAHPDPGTKIKF
WDCPETLQNPGRRTASKRGRLLDRMAVDQDSDMVVLAGRS
Download sequence
Identical sequences ML149625a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]