SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML215423a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML215423a-PA
Domain Number 1 Region: 799-1160
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.23e-83
Family Reverse transcriptase 0.00062
Further Details:      
 
Domain Number 2 Region: 298-424
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000137
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 3 Region: 221-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000877
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 25-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000119
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number 5 Region: 95-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 256-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000072
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML215423a-PA
Sequence length 1476
Comment pep supercontig:GCA_000226015.1:ML2154:171887:187535:-1 gene:ML215423a transcript:ML215423a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNPKDVCNGVQDCSDYSDEIEPCESTFMCPGRQWISGTSLCDGVNHCGDWLDEVYCETS
RGFSCAAQNGTVSWFHQDRLCDGVQDCGDSSDEQYRVCQWIGFNCTETTGQWVTRDKVCD
GTPDCQQGEDERSCTDFLWRYSMSFDGGMTIKREEKESVPESLLCNGVGDVHDKLDECSE
SCGDSTPEFCSHLCGAGWEYNNTNCGCRGYKYGLLTFEVGFNCYESDNRTCISPASLCDG
ILDCAKGEDERNCSQFFYCDSGRPYHVSRHLVCDGRRNCYDNSDECQQCNLDVLSDDEHI
IANPILRGLVWIIGLASLLGNFFVILCAVRTLKTENKITTVALVNKQLIINLASADFLMG
VYLISLGTMDEIQKGHYCLEATEWKLSGMCQTLGVLSVLSVQTSVMSLGVLSTYRMLIVI
RPHSTDTTRIFDPQRNLAKSQGVAPPNELLLETRRLSSKVVYHDSRFKLELSLLYHVVRF
CYIFIHYGQLYPHLQVISWESPGTKQEESCEQRPTKEDRKTYCGGFLLLGPSLHVRFTTA
LTGAQKLAALVNCVSPGVYSYISAATSYEAAIAILKDTYESPKNEVYARHVLSTRKQKDG
ETVDEFMHQLDVLSKDCTFTDVDKVAYRDEYVRDAFIRGLYSPEIRQRLLEECANRTDTF
KKARTLELALKNNQQMQDKSFSCLAVEPDRQDVNEQNDTFCAAAVSNPQFKERQKTHNAC
YFCGNRYHPRSDCPARELTCHLCGKKGHFGKVCKSGKRCNRPNTNPSQDYQRSAAMYPPY
SLSDSVVNVKRLFEFISLDAKPIACKSRRFSSSDKQFIDMEIHHLLSEGIIEPSTSPWRA
QVLVVNNESSIHRRRLVVDYSRTINKYTMLDAYPLPNLDELAHKVAQFSIYSSYDLKSAY
HQVPLHELDKIYTAFEASGRLYQFTRIPFGVTNGVAAFQRFMDSVIDSEKTEGIFAYLDN
ITIGGIDQADHDSKVERFEQIVSKYGLTLNHSKTISSVKEIGMLGYLISKGQIKPDPARM
KPLLDLPTPCDHASLKRVLGLFSYYMSPNDKDLLVVETDASGYALSASLNQNSKPVAFFS
RTLNQHEKLHSAVEKEACAIVEAVRKWRHYLSGRKFLLVTDQQAVSFLFSKRNVRGTAKN
EKIARWRVELSCFDFEIKYRPGTANLAADCLSRAYCAAMSHPDALSELHIDLCHPGITPH
ERLFNYTRKSSYTDTSHLPNWLTEKGKVLLKRHVRSSKYEDLCDEVELLETNPTYARVKL
ANGVDKTVSLRDLAPLPRSQPKEPAGSQSDTCVFPPKPVPSIDLRYPVALGTDNPSFSDS
TVTTLGPKHPVVVNPPTPTLRKSQRLADPPDRLNYDKLGGPENWVESNRVFAEAERERER
RGEESLIAMLSNAYYDVLDDDGDGTVSVDELKTMMKAFDVPRKLPIPSSRRQTLTRVERS
SDQSWSISSESSGWSPTILSGTVSTLTNTEQRFHRV
Download sequence
Identical sequences ML215423a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]