SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML32093a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML32093a-PA
Domain Number 1 Region: 969-1088
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000256
Family Rhodopsin-like 0.005
Further Details:      
 
Domain Number 2 Region: 665-697
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 732-898
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000458
Family Rhodopsin-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ML32093a-PA
Sequence length 1166
Comment pep supercontig:GCA_000226015.1:ML3209:38710:42210:-1 gene:ML32093a transcript:ML32093a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKQILVLVAKSPTVFKIVLYFVINFEKAYLWNNFEAFTTRPRWAGSVQEGPTWIDEADA
ERCSFEIINGFMKEVCYISGIKYFKCSNSDGFYGILLESCEETVFTRLCPEDKVFYQACG
RGKCGIKKEREMGVSTYNPGDWNSIAACGETICVSASYIYLTNLMRDYTAVAGNEKLWNI
IRCDNSSSCSNTINGVAIDEYGCEDSEDLVDVCSYESSISWPIKKEQVCDNKCDCNECEE
EANCHNMTRGIFCKHIYLNTEIYVQPLQICNNKKDCKSGIDELICRDYTETCETQSVHPI
NKYGEKIDSNIERRVLTPLSKCTVPETRPLKMKKMCVDYRDQMNCSFSTVSHLTCDVDGY
PTTISDLIVCKVEPVIKEKLCDDGLDKKCFNPEHDCRIHKHRLCDGIKDCLNGYDENAQL
CTEMVEIKCVRKWSMTKLSIRFPLQWVLDGISDCTNNIDEDPGKWIKTCGYGIRDQYHYN
TRNNVVTSCMSTQLKCPNGPEKMNLDRICLGKTYNCDWEICNAARKNYQITSTVPSKVNG
TKTKQLFYCIRGLKDLEDKNGECLPIRLSHQKKLAGIDDIHVSISKKYAKYHVDCRNLFG
ELYVYVACSDLCGDVAACPLKPTTVYSTARSAVCTNYPKDQLVLSLNEDNKLGVAIRKHR
SVLTKAIFVCNSGHCLSYEKVCNLVVDCRDGSDETNCTNNFKCKISEEFIPLSRKCNGEF
DCYDLSDECNEECSNQTLMFTHVSMFVVAFLFGFVATLFNFINLFNGLREFPKLKTDTAQ
VNKSFVLLITFSDLLQGVFLILLSVGDKYFNKSTCTTQFEWTTSTTCSMLGVFSTIGSLL
SLYSMTILSVIRATKIRSIVAPRDNMSSKMKVFLSVTVFGLLLFSTLVATLPLVILEDYF
ILNLKYTGSSLFVGAPDKDKHMTIIDSYYGRVLKSNIGKGDADLPWSEIRNLVNDMFTND
IAGTNLGFYGNNGFCLFSYFVRKDFSYRWYSICVLSTNLLCVLIIGGCYMFVNIFARKTA
SAIKNSPTAKGNRKLQRKITIIVTTDVLTWLPFIIVCCVNYSEVVDTSSWYSVFCIFFLP
INSIINPIGIYDETIFYWCLRIAKKVRSVFRLVLRKLKIDKSRSAEASCHVNEGAEMCNL
SPVMNRTNASSPAQYEHKHKLKLTSV
Download sequence
Identical sequences ML32093a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]