SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML409410a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML409410a-PA
Domain Number 1 Region: 603-774,848-956
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.2e-18
Family Rhodopsin-like 0.0072
Further Details:      
 
Domain Number 2 Region: 531-565
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 162-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000113
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 4 Region: 566-597
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000916
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML409410a-PA
Sequence length 1085
Comment pep supercontig:GCA_000226015.1:ML4094:12728:16866:1 gene:ML409410a transcript:ML409410a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFHSSQEYTAICENDGGSYQACGHVTCAQYQYQRDGPMLCGSFICDYYLEHTWYQNEIG
EWWQKEDPAYVMQGGNEMTYYFLCDGRYNCRNTKKDEQYCEDEMLICNNEEYVNKTNQCD
GECRCYLCQDEIGCNKEYDNHGMYCNNTFNFRIGFNIWYTPYLPPSVMCDGFQDCRDGTD
EVNCTGTETCVSTENLGSKILTLTDRNRCSVPNELYLVCQNYRDQLNCSHVLDSPLSCKV
NGYMTTVSRYALCKETSLCDNELDKKCDAAEGGCIIHKHQFCDGYRDCTEGKDEDSTVCT
TLTRQTCKRKLAYKTPREDLQIPLTWVGDGVEDCIDGKDEDYDSWKVCGEGWSSRFQDFG
TVCSDVFLCSNISREFEEYGNLCDRAGTCKKETEICEVSRDLPRLQIQAVVRHDGHIFIG
YHLPGLTKLEKEPSLGNHTLTPFTAPDKPFGVPPQPVTIAMSSVHHSVCSFVYGELYVYL
SCSGACGNHTSCIVGEVKFDSCHNIEGSSLVFTLSEQNYLTVASKTKGNYVSNLFPCNNG
YCVTYDKVCDLVDNCGDGSDEVNCINHFKCETSGQMIPLSSVDDGQYDCTDLSDECSAAK
PIIETPVLSVISWLIGVPATFFNAIVFIKSIVQLKETASPFKLLNRHMILLISLGDLLVG
MYLIVLSIVNVLLKDTYCRERFEWLTSGYCAAMGVVSSTGSQISLFAMVVLSLCRVITIR
RIQPNTSGRKFARLVSGVLVVFVIVSSFVISYLPLSNRLEDFFVNGLYYDKTIRLFIGAP
SKQKHIAILEKYYSQFRGDPDLPWSTVRRLVRNMFSQTYGGVDSVRLHFYGNDGVCLFKY
FVTPEDPQAFYSLTILLLNFVCFFIITLSYVLISLQSLASSRRLKRNSQIEKALRKRNSS
LHRKLTMIILTDFFCWVPFIVVSALHYFMIVDASPWYATFSILILPINSVLNPLLYDPYF
GTLLDKAWRSAKRKLGFTTITDSTAIVTLHSQRTTTAYEHSVRHCASNAPISSTQISVEV
LSKNKGKEEDTTFPKDQETTLQLPAAERRAKRMERRKTVLSKCTPTDEEITESKKDPEQN
SNEIE
Download sequence
Identical sequences ML409410a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]