SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ML45135a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML45135a-PA
Domain Number 1 Region: 65-111
Classification Level Classification E-value
Superfamily PX domain 0.000000000458
Family PX domain 0.0052
Further Details:      
 
Domain Number 2 Region: 154-190
Classification Level Classification E-value
Superfamily SH3-domain 0.0000408
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML45135a-PA
Sequence length 192
Comment pep supercontig:GCA_000226015.1:ML4513:46425:49576:-1 gene:ML45135a transcript:ML45135a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCYHDSLQKRTQVKITAKDRRKWAFLRNGFAESHFLIRPGPYRKRALKSNTYQKMGDKE
INEVVAATIVATKKIKNPDKFYVYVMRLTRKNKSVSVIYRRYSEFFQMHLSYQKLSLCNA
ALRQSQRSHNPYYITSLSDDADTKNAAEEIGGPVALEEYEAIEDYAPKDKKSVKLVAGEV
VEVVEKNESGQS
Download sequence
Identical sequences ML45135a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]