SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000063 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000063
Domain Number 1 Region: 148-239
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.96e-23
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0019
Further Details:      
 
Domain Number 2 Region: 307-389
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000596
Family UBX domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000000063
Domain Number - Region: 9-81
Classification Level Classification E-value
Superfamily Tropomyosin 0.000458
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000063   Gene: ENSMGAG00000000686   Transcript: ENSMGAT00000000694
Sequence length 392
Comment pep:novel chromosome:UMD2:25:21061:29938:1 gene:ENSMGAG00000000686 transcript:ENSMGAT00000000694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTDMELMSSMMQKISLLEQKIDKQAQEIQLKDRKIAELEEKMKTLQKGEDGPESSAAEDL
ETRCLQLQTQVWEMERFLNDYGLIWVGDRHEELEDLESLRDDELLAKRFWKPGEAVVSKH
QVDFDLILENVKSLNMLAGDGVSHVEHTPGGARLRQPEPLPLTLYQNGIVMLDGPFRSYE
EQSAQQCLQDIMDGYFPSELQARYPDGVPLQVTDRRDVVFQERDLPGSFPGHGQVVGHSK
LSRVEEPTEIPGKFLHLSQKCISQREELKPHWGSYRDNRVSACYTLQALVCLCVEHSFLT
SSLERAEEAGASAPEVCTLRIKSESGEQMYVIKMLFSETIGDLRLHLAHARGGDSDSYEI
ISTFPQRVYADNSRSLQECGLIPSASLLLRRR
Download sequence
Identical sequences G1MPU6
ENSMGAP00000000063 ENSMGAP00000000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]