SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000183 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000183
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.43e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000841
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000183   Gene: ENSMGAG00000000806   Transcript: ENSMGAT00000000816
Sequence length 726
Comment pep:novel chromosome:UMD2:9:151943:163346:-1 gene:ENSMGAG00000000806 transcript:ENSMGAT00000000816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FILDERVQLTVGLQTQERHLILFSDMLIIAKSKSSSSLKFKKQVHLTEVWTGTCLSEVTE
KKMSPENSFVIGWPTINYVVTFSSADVKKQWLSALLWHISEMKQKEYLKNLNLQIFVLDA
ENCSSTTTVNVSNVETAESVMKKTLVQLGLPGRTSDHHLWVISGKDDPAYPLIGHEHPFS
IALNCLRDSADQQQGTHDHTLLLDGTEASFLEQLPREKQCQFVLKPRLQAPVQLRRESLQ
KHTKRKKSLIDWALRRSTSTPTDSPPLQSPTTPQKLFGMSLSSVCPDGILPKPIMDMLFL
LYHEGPSTRGIFRRSANAKTCKELKEKLNSGDDVQVDGESVFVAAAVITDFLRNIPDSVL
SSDMHGLWMEAVDTENRLNKIETIKSLVNQLPEANLVLLRHLFGVLHHIEQNSVVNQMNA
FNLALCIAPNMLWLPSPTGPEEESRSTKKVAMLVQFLIENSAEIFGGDIVSLFQRPDKNS
TNSERSRGKLVAFYLQGIVKIFLIGEALIFSLSGMAKKGMAQNDDSSDELEFSAYDLERP
KHRLMPKADDVFEAPSGLLLDEEQEDWDLFSEITACYQSKTQKNASADSPARDRCSSEPS
VCLSSQLPAQSHEPVARQSSCDATIMHNHTGYIHRLKQLQVESQKLIDEGLSTGANKARQ
NLWHSPQTSSKVKKLNFQKSNLSNRSSFSSLSSTTTSPSASSLSSLDSAFSYCSESSAVS
PTDVSS
Download sequence
Identical sequences G1MQ47
ENSMGAP00000000183 ENSMGAP00000000183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]