SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000321 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000321
Domain Number 1 Region: 660-751
Classification Level Classification E-value
Superfamily PX domain 4.58e-24
Family PX domain 0.00069
Further Details:      
 
Domain Number 2 Region: 10-184
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-22
Family RUN domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000321   Gene: ENSMGAG00000000919   Transcript: ENSMGAT00000000957
Sequence length 819
Comment pep:novel chromosome:UMD2:16:110526:183596:1 gene:ENSMGAG00000000919 transcript:ENSMGAT00000000957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGSQNNDTKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLRR
SRGLALTAAAIKQAAGFSSKTETVPKHWLCRKPKQKHHRNRFTPGKILCKGKNASRTLFY
CSLQNVQLEKYLKAKLLVDSNDLGVFYEDWSFMMDEERSSMIPTMAAGLNSILFAINIDN
RDLNGQSKCAPTVSDLLKESTQNVTSILKESTQGVSTLLREITASSAVSILIKPDQDTDP
LPVLSKNVNAELKYKRDRKKKKRVTNIISFDEENDELNLGDATKTPIMGQSSEESLDRSS
VFILPSSETNHGKNSNENESNHSWKSNSVFMNGEYEYQKLDVKSIDDEDADEDELCGKTL
GNKGTEAENESSERPHEIVTCNSEICSWTPLQVLNYDSDVLFPVSAADSYSQTVYALVAS
ALLGTAFKEWCGPYLEDQILKVEVSPPAQVNTLSNMLPSATMPESMTINELRQAILAMMN
RKDELEEQNRSLRNLLDGEMEHSAALRQEMDNWRRKVAEQEERHATKVQALARNRENEVL
KVQLKKYVGAVQMLRREGQAVEVLPNIWSTDGELTIPEQKQVENNEELASSYERKLIEVA
EMHGELIEFNERLHRALMAKEALVSQMRQELIDLRGPVPGDLSQTSEDQSLSDFEISNRA
LINVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNVYRRYAEFRSLHHKLQSKYHQVRTFN
FPPKKAIGNKDAKFVEERRKQLQNYLRNVMNKVIQVVPEFTANPKKETLIQLMPFFVDIP
PSGEAVSKSSCLRVTTRFPKLSRSHQREPRSLEPQSGDL
Download sequence
Identical sequences G1MQG8
ENSMGAP00000000321 ENSMGAP00000000321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]