SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000324 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000324
Domain Number 1 Region: 970-1268
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.28e-84
Family Complement components 0.0000312
Further Details:      
 
Domain Number 2 Region: 1339-1467
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.58e-38
Family Alpha-macroglobulin receptor domain 0.0000335
Further Details:      
 
Domain Number 3 Region: 802-922
Classification Level Classification E-value
Superfamily E set domains 7.84e-37
Family SVA-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000324   Gene: ENSMGAG00000000841   Transcript: ENSMGAT00000000960
Sequence length 1475
Comment pep:novel chromosome:UMD2:29:923386:934530:1 gene:ENSMGAG00000000841 transcript:ENSMGAT00000000960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHGLEPRMANIALVISAGPHWLLIPNLIARLGKSRHYVVTSPAVFYHPYSATLWVHLSNV
HQPTQVTIQLQRADEAGNITLLERKVEEPQLLLNVTFPAPAPSKGKEEIAHLYVSIQGES
LNTTRKSVMLRLLEPGIFVQTDKAVYKPGQQVKFRIVSLDKDFVASDKKLPLVFLKHAKD
PRGNRIAQWRDVSPRQGIVDLSLPLAAEPALGTYTIHVEGKTHSFSVEEYVLPKFEVTID
FPSSVWVKDEKFQLQICGRYTYGKPVQGKVHATLCQPWSFRRYSDVLEESKDICTEVDGQ
TEKNGCFSTEVSMSSFNMSNYRLRKEFQVKASLVEEGTGVEMNNTKTCKILENILTVTFE
NTDDFYKRGLPYTGTMRLKRADSSALGGQQLVLLVNSKRHSFLTDESGTASFELDTSGWT
ETVRLVGEVNVSADSQNGASLSTINRAYLNLRPFFSKSQSFLHIHRLKGKLSCSQLEQLQ
VDYILNKEALGSKLQSLDVVFLVLAKGTITNILRKELPLSAGLRGSFSLELHTSPELAPT
ATVLCYAVLPNGEMLADSSYLLALGFRTQVKMAFSKEQALPGSTVKMELEAASGSLCAIR
AVDRSVLLLKPEAELTVAEIYKVLPSFDYPGRIRDPSPCTWYHHHFHTIIMGEPEDMRRS
RRYILPPYWDDIQMNPSQLFQNAALKLLTNAKTRDDCKEYYKPLYFARGVPGEHPANMYM
PMVESRVGIPAVPSLPYAPSKEEEPPAPRVHFPETWLWDLVPVGEKGSAEMVMTVPDAIT
EWKAEMFCTAPVGLGLAPATTLTVFKPFFVDLALPYAVIRGEAFSLVATVFNYLRQCLRV
QVTLADSAELEVSAVAGAVYSSCVCADEAKTFRWDVKATNLGEVNITISTEAISSEELCG
NEKPVVPAQGRVDTVIKPLLVQPGGILVEKAHSSLLCKEASEEVSLELPANILEGSQRAH
VSVMGDIMGNALQNVDRLLAMPYGCGEQNMVRFAPNIYIQQYLEKSGQMNADIRAKAQGF
LQSGYQRELLYKHSDGSYSAFGETDESGNTWLTAFVLKSFGQARAFVAIEERHITDAQHW
LQKQQQESGCFRSVGKLFNNALQGGVSDELSLSAYVTAALLELGMSPMDPTVSSALKCLE
ASSTDNLYTEALLAYVCGLAGREEQQQARLQSLLQRGTSTDGLLFWKRKEKALSTESSWA
EAAPAEVEMTAYVLLAYLTQPQVSRADLAKASQIVRWLSKQQNPYGGFASTQDTVVALQA
LAKYATLTYSDNGDLAVTVTAPTGSKQDFVLEASNRLVLQRAVLHDLPGLYGVKTHGQGC
ALVQVTLRYNMPPPPSAGTFELSVETEPKTCTSDASTHFRLLLRARYTGNRAATNMVVIE
AKLPSGYIPDKSSVVKLKRQNLVKKVEVQSDQVTIYLDQLTKEEETFSFAATQDFPVRNL
QPATVTLYDYYETGDRTDAAYSAPCSSGRAEGPSL
Download sequence
Identical sequences G1MQH1
ENSMGAP00000000324 ENSMGAP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]