SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000389 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000389
Domain Number 1 Region: 168-364
Classification Level Classification E-value
Superfamily E set domains 5.13e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000457
Further Details:      
 
Domain Number 2 Region: 61-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-23
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000389   Gene: ENSMGAG00000001003   Transcript: ENSMGAT00000001026
Sequence length 420
Comment pep:novel chromosome:UMD2:26:1160864:1171335:1 gene:ENSMGAG00000001003 transcript:ENSMGAT00000001026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQDMDIGVASREPKKIPKQARDDVPIATDRTRLITAEGKKPRQRYMEKSGKCNVHHGNV
QETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYIRGDLDHLEDENWI
PCVENLSGFVSAFLFSIETETTIGYGYRVITEKCPEGIVLLLIQAILGSIVNAFMVGCMF
VKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTKEG
EFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRTQLEKEEFEIVVILEG
MVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKDFYEVDYNSFHSTYETNTPVCCAKEL
AESRREGQLLSSISSATVLGGGREAETARGEEEEEEEDREPAAFSGANGTAGEVKEDLPV
Download sequence
Identical sequences G1MQM6
ENSMGAP00000000389 ENSMGAP00000000389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]