SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000399 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000399
Domain Number 1 Region: 400-512
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-27
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 11-106
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-20
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 3 Region: 219-314
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-16
Family PDZ domain 0.032
Further Details:      
 
Domain Number 4 Region: 683-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000168
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 459-481,513-595
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000042
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000399   Gene: ENSMGAG00000000963   Transcript: ENSMGAT00000001036
Sequence length 927
Comment pep:novel chromosome:UMD2:30:785103:792276:-1 gene:ENSMGAG00000000963 transcript:ENSMGAT00000001036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRWQVAAMEEMLIWEQHTVTLSKDPHRGFGFAVSGGRDRPNRVTGDTAVIVSDVVSRGPA
FGQLQRKDQIVMVNGLSMENVSSSFAIQTLKTCGKIANITLKRQKKIHLPMSKSSPASPA
ATRRYDSDEDFDPRGVDPALRSASQHRSRDDLDHNQGYDGDSSSERSSGHHQDDRRHHKS
SRSRRRSQDSSHWRQSPDSGSEEGDTNGLALVSGFKRLPHRDVPMKPITSVLVKKKEDEE
YGLKLGSQLFIKHIVESGLAARRSSLQEGDLILKINGVASKDMSLADTQRLIEQTEGILT
LLVLRDHRQFLINIPNMEDYQSDSSRMDDISDIDSDLSHPPSPKTSPRLPAAARMNSPGF
CSRERRQSSKNAAINTNMDDALSHDMLEAVEQDGHHSPHSRPSARAAPKDGYSPDSRVVQ
FVKARSVGLQLAGGNDVGIFVSGVQEGSPADSQGIEEGDQILQVNGTSFQNLTREEAVQY
LMKLPPGEDVTLWIQSKQNIYRKMISSNVRDSFYIRTHFDYEKDTPSGLSFARGDVFHVL
DTMYRGKLGNWLAVRMGRDLQEQEKGIIPNQSRAEQFASLESVLKTTPGTNPSGARAEFW
KLGLRGAKKTLRKSREDLSALTKQGHYPPYERVVLKEASFKRPVVILGPITDIAMQKLSM
EQPELFEIAPSVPRDGASSKVIKLDSVRQIAEKDKHALLDITPSAVERLNYVQYYPVVVF
CEPESRQGIKAMRQWLAPDSRKSSRRLYAQASKMKKYCSHLFTATITLSGSGNAWYEEIK
NIIRTQQSQPIWTAAEHVDAALEDGLELLNPPSRAASGYLTCDSHANSDYDDTDGEGGYT
DGEAEDAYSHPALSRSSEPAQTYPSHGVSEQVGPPQHSQVTDQQPQGQWAQEHLRDYEHE
AVRKRFTRARDDSDEDEGYEWGPATDV
Download sequence
Identical sequences G1MQN6
ENSMGAP00000000399 ENSMGAP00000000399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]