SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000621 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000621
Domain Number 1 Region: 128-371
Classification Level Classification E-value
Superfamily vWA-like 6.35e-85
Family Integrin A (or I) domain 0.000000348
Further Details:      
 
Domain Number 2 Region: 382-457
Classification Level Classification E-value
Superfamily Integrin domains 5.07e-20
Family Integrin domains 0.00095
Further Details:      
 
Domain Number 3 Region: 631-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.14e-17
Family Integrin beta tail domain 0.0045
Further Details:      
 
Domain Number 4 Region: 29-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000167
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000621   Gene: ENSMGAG00000001073   Transcript: ENSMGAT00000001265
Sequence length 781
Comment pep:novel chromosome:UMD2:7:151542:158232:1 gene:ENSMGAG00000001073 transcript:ENSMGAT00000001265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPSRPEPLSLAGSQERLMVLCSTAFAAECPKIKVGTCKNCIQSGPGCAWCKKLNFTKAG
EPDSNRCDTIEQLQQRGCPENEIEFPVNEIKRMQDSAFSNKIQLTPQEVHLKLRIREPAE
FDVKFRRATGYPIDIYYLMDLSYSMLDDLENVKKLGGQLLRALESTTPSRRIGFGSFVDK
TVLPFVNTHPEKLKNPCPNKDSNCQPPFAFKHILSLTDNAEKFESEVGKQFISGNLDAPE
GGLDAMMQAAVCGDLIGWRNVTRLLVYATDDGFHFAGDGKLGGILTPNDGQCHLEDNMYK
KSNEFDYPSVGQLVQKLAENNIQPIFAVTSKMVDVYKKLSEMIPKSAVGELNEDSSNIIE
LIQVAYNNLSSRIILDHSTLPDVLDVKYDSICNNNTGTKNEARGQCDNVKISDEVTFKVK
VTANECIKSQSFTIRPLGFTDTLTVHIDSICDCDCREQPDPTACSGNGEVVCGICSCNLG
YTGKNCECDTKGRTSKELEGSCRKDNSSVICSGLGDCVCGQCACHTSDVPGKEIYGTFCD
CDNMNCEFHNGSLCGGEDTGGWSQCPSCMSAFPCCPHRTPPRRAALVPEQGSFQAEAVXC
SLRGSCHCNRCQCRGGYQPPFCEECPGCPSPCGKHISCVECKSFSSGPLTKNCSVACTNI
QLTDQPRAGSRQCKEKDSENCWISFFMAQDDGEEMYTVTVDPKKECPEPPNVALIVGSTI
AGVALIGLLLLLIWRLLTEIFDRREYRRFEKEKSKAKWNEADNPLFKSATTTVMNPRFDG
Q
Download sequence
Identical sequences G1MR51
ENSMGAP00000000621 ENSMGAP00000000621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]