SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000800 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000800
Domain Number 1 Region: 354-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-83
Family Protein kinases, catalytic subunit 0.000000000522
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-26
Family PLC-like (P variant) 0.0000019
Further Details:      
 
Domain Number 3 Region: 213-282
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-22
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00011
Further Details:      
 
Domain Number 4 Region: 139-208
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000800   Gene: ENSMGAG00000001305   Transcript: ENSMGAT00000001446
Sequence length 701
Comment pep:novel chromosome:UMD2:14:1305485:1334730:1 gene:ENSMGAG00000001305 transcript:ENSMGAT00000001446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRISFNSFELGPVQNQGEQLQPFCAIKMKEALTTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMKAAEEPLSEVTVGVSVLAERCKKGSGKAEFWLDLQPQGKVLMAVQY
FLEDADCRQSMREEEGTVTINRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGL
NKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTMFQKERFNIDMPHRFKVYNYMSPT
FCDHCGSLLWGLVKQGLKCEECAMNVHHKCQKKVANLCGINQKLLAEALTQVSQKSTRRS
DSGSVENVGIYQDFDKKPRGPGGDTTADSQYDKLWEGSTAKPAPRIASRRKFNIDSFVFH
KVLGKGSFGKVLLAELKGKNEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTH
LYCTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYGAEILCGLQFLHSKGIIYR
KLTNIITEHNWSSFRDLKLDNVMLDKEGHIKIADFGMCKENVVGENKASTFCGTPDYIAP
ENKILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKES
KDILEKLFERDPTRRLGVTGNIRAHPFFKTINWTTLEKREVDPPFKPKVKSASDYNNFDR
EFLNEKPKLSYSDKNLIDSMDQSAFDGFSFTNPKFEQILEK
Download sequence
Identical sequences G1MRI6
ENSMGAP00000000800 ENSMGAP00000000800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]