SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000824 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000824
Domain Number 1 Region: 11-100
Classification Level Classification E-value
Superfamily PX domain 1.1e-20
Family PX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000824   Gene: ENSMGAG00000001377   Transcript: ENSMGAT00000001470
Sequence length 168
Comment pep:novel scaffold:UMD2:GL426396.1:171:1000:-1 gene:ENSMGAG00000001377 transcript:ENSMGAT00000001470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLLPWKDEGEDEQVQVFLVEVLCNGRRHTVAKRYSEFQALHKRIKKSCKVPDFPPRRVP
NWVPKVLEQRRQGLELYIQGVLCHNEELPQDVLDFLKVRRSQQEPKGCSPVPLTSLSCHS
VSRSPSQRPVLGFRTDPYTRPPAMDVLPNAVLSGVLQGLYTPWHCPPC
Download sequence
Identical sequences H9H088
ENSMGAP00000000824 ENSMGAP00000000824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]