SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000920 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000920
Domain Number 1 Region: 21-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-18
Family Ubiquitin-related 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000920   Gene: ENSMGAG00000001469   Transcript: ENSMGAT00000001568
Sequence length 169
Comment pep:novel scaffold:UMD2:GL424691.1:4655:7114:-1 gene:ENSMGAG00000001469 transcript:ENSMGAT00000001568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQHQHRAAGLSSAPPGPHSPSSPRAARLXFLNDTERLARVRPGDTVGALKRAYFPGQEQ
QVRLIYQGQLLRDDAQSLAALHLAPNSVLHCHISQHSPAPAPTGPRASADPVHTALNVGS
LMLPLFVLMLAVLWYFQLQYRHVFTATATTFLAGLTLLFSFMAFTMYRR
Download sequence
Identical sequences H9H091
ENSMGAP00000000920 ENSMGAP00000000920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]