SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000951 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000951
Domain Number 1 Region: 35-126
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-26
Family PDZ domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000951   Gene: ENSMGAG00000001484   Transcript: ENSMGAT00000001599
Sequence length 140
Comment pep:novel chromosome:UMD2:9:1212235:1214577:-1 gene:ENSMGAG00000001484 transcript:ENSMGAT00000001599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRLPYDDFPVVFLPPYESPPAWVPPHERVYHPDYNNELTQFLPRTVVLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLSVNDVDFQDIEHSKAVEILKTAREI
TMRVRYFPYNYQRQKERTVH
Download sequence
Identical sequences A0A1D5PJR4 G1MRU8
ENSMGAP00000000951 ENSMGAP00000000951 XP_003208324.1.16129 XP_015133708.1.86415 XP_015715560.1.68032 XP_021262241.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]