SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001062 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001062
Domain Number 1 Region: 143-693,869-1062
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-255
Family Motor proteins 0.00000000237
Further Details:      
 
Domain Number 2 Region: 2128-2315
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000703
Further Details:      
 
Domain Number 3 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000248
Family Ras-binding domain, RBD 0.0076
Further Details:      
 
Domain Number 4 Region: 2065-2121
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000114
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 1109-1161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.035
Further Details:      
 
Domain Number 6 Region: 1072-1114
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000425
Family Motor proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001062   Gene: ENSMGAG00000001473   Transcript: ENSMGAT00000001713
Sequence length 2541
Comment pep:novel chromosome:UMD2:12:687576:824206:-1 gene:ENSMGAG00000001473 transcript:ENSMGAT00000001713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNDVGGRRRFEDSEYTLHIYPGSIAEGTIYCPITARKTSTAAEVIDSLINKLQLEKTK
CYVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRTSGEDYRFLLREKNLDGSIHYG
SLQSWLRVTEERRRMVERGFLPQPQQKDYDDLCGLPDLNEKTLLENLRNRFKQEKIYTYV
GSILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRRKNQCIVISG
ESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKF
IQVNYQETGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEERSAFHLKQPE
EYHYLNQMTKKPLRQSWDEYCYDSEPDCFSVEGEDLKHDFERLQLAMEMVGFLPKTRRQI
FSLLSAILHLGNIRYKKKTYRDDSIDICNPEILPIVSDLLEVKEEMLFEALVTRKTVTVG
EKLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDMEESTKTLSIGVLDIF
GFEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRAEGISWHNIDYIDNSGCINLI
SKKPTGLLHLLDEESNFPQATNQTLLDKFKRQHEGNSYIEFPAVMEPAFIIKHYAGKVKY
GVKDFREKNTDHMRPDIVALLRSSKNAFICGMIGIDPVAVFRWAVLRAFFRAMVAFREAG
KRYVEKKTGHDDAVPCAVLKSVDSFSFLHHPVHQRSLEILQRCKEEKYSITRKSPRTPLS
DLQGVNTINERSQWDAFAVGWNGRMGMRHSRLTSPSSFLDKDGIFVNATNSKLLERAHGI
LMRNKNCKAKPNLPKHMLDVKSLKHLTNLTLHDHITKSLLHLHKKKKPPSISAQFQASLN
KLMETLGQAEPYFVKCIRSNAEKLPLRFSDSLVLRQLRYTGMLETVRIRQSGYSCKYSFQ
DFVNHFHVLLPQGINPSKHNVHDFFRKIKLNPDNYQVGRTMVFVKERERQFLQDLLHQEV
LRRIVLLQHWFRSMLCRRQFLNMRQAAVIIQRFWRSYQSRKQGKPSPDPLVLSKAALVLQ
THWRGFVERRRFLQMQFAAHLIQSCWREHLKRRHEAAASIQAAWRGHRAQQWYRASRRGV
LCLQAACRGYLARQRFRALKEQRLKEMQLENGLSIREEDGLEEDGALEIKGSDPSKWEDG
SFEERVRAIEEHKSLMENNRVNHLDLLDTSATSSYKRHERASSQSGMDTEEEVIVRERPK
SLEDLNQKKVVRAKRESRRMRELEQAKFSLELLKVRSTGGLSPSEERQWSTELVSEALHS
PQGTPESESSQGSLEMLSCEDTPSKHVPLDVQLLPTESRDSLPSSPQPHLQDKSFCAADV
NSNLSICRRMLSDSELPDNRTAKEHVVCDPQNIYRMHPRETFLSSNLPTFYIPPQDNVKV
KQSQVDNNLKNKAVEREEKTALFSEMRREERGTAAATQTHSPDSVIKRLEKLNVEKEERQ
KQLQLQNEREMMEQIRQQKEILERQRKAFEQLEKQGRVEALQRAELSRMKDPALKPSKKP
DSRPQSVLILHTQNRTEHSVAPGGTPASSVDIKGLTVGSRGGSPAHAAPKDRPVSMFMER
REGPAGAALESRGNPRLAADPRLNCRITVTSKSHQAISRCPRQSLQHAKDGKAVVGFSPA
SPLGMPFSREASHQCLPKGELARKPFKMPGSGRGEVPRPTHKKKARMARTRSDFLTRGTF
ADGEGDTEEDDYDGNFEFLLSSDLPPHPEAGPAARLGQACYSDSEMTVQRFSSGDGQPKL
HKTMSQGEIGKLAATQKPLAPDGRSQRAKMRFWVKGKQGEKKTPREKLATQSELLELYAE
QEVPSRELLPLELGPHHLTPPRSPELSGIYRREFKENKEPSPKVKRKRSVKISSVALEPV
QWQNDSLQIITSASDLKSMDEFLLKKMNELDSEDSKKDTLVDVVFKKALKEFRQNIFSFY
SSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDWSESPVKVWVNTFKVFLDEYMIEYK
PLDYTAVKVPKTERKKRRKKEADVVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVC
KLCKYACHKKCCLKTTTKCSKKYDPELSSRQFGVELARLTSEERAVPVLVEKLINYIEMH
GLYTEGIYRKSGSTNKIKELRQGLDTDIDNVNLDDYNIHVIASVFKQWLRDLPNPLMTFE
LYEEFLRAMGLQERRETVRGVYSVIDQLSRTHLSTLERLIFHLVRIALQEETNRMSANAL
AIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVIEQMNKYKARLKDINSLEFAENKAK
SRLSLIRRSMKPVLIAVRFMSITRSSIPGKGRVRRGTYPSPTSPVAVRLPSVSDVPEETV
SSEEAMELDVTEQQQAAMQQEERVLTEQIESLQKEKEELTFEMLTLEPRASDDETLESEA
SIGTADSSENLNFDSEERSVALSSLRPIKAEGPGRLRRHPRMRPDVADTPNPSLVSSSSS
SSSSQSSTSCLPHLPRKRFQM
Download sequence
Identical sequences G1MS32
ENSMGAP00000001062 ENSMGAP00000001062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]