SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001232 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001232
Domain Number 1 Region: 14-182
Classification Level Classification E-value
Superfamily E set domains 2.55e-72
Family Arrestin/Vps26-like 0.000000407
Further Details:      
 
Domain Number 2 Region: 184-393
Classification Level Classification E-value
Superfamily E set domains 2.1e-62
Family Arrestin/Vps26-like 0.0000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001232   Gene: ENSMGAG00000001696   Transcript: ENSMGAT00000001884
Sequence length 403
Comment pep:novel chromosome:UMD2:11:2280570:2294634:-1 gene:ENSMGAG00000001696 transcript:ENSMGAT00000001884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQKTGKNADSSPKQVIFKKSTRDKALTIYLGKRDFIDNIGSVEPVDGVVLVDPTMIKGKK
VYVSLTCAFRYGQEDIDVIGLTFRRDLFFSRVQVYPPENKPESLSHLQESLLKKLGKNAY
PFFFTFPDYLPCSVCLQPSPRDVDKSCGVDFEVKAFSTENLEERIHKRNSARLLIRKVQF
APEEPGPQPCAETTWQFFMSNKPLHLKACLSKEVYYHGEPIPVTVMVTNSTEKTVKKIKV
QVEQVANVVLYSSDFYTKVVAAEEAPEKVQPNSSLTTTLTVLPLLANNRQTREIALDGKL
KDEDTNLASSTIIKDGIDKTVMGILVSYKVRVKLTVSGLLGDFTSSEVSTELPFRLMHPK
PEEKNPAGEGKNDAEMVFEEFARQQLKDTGDEEENKNVSSTDE
Download sequence
Identical sequences G1MSE9
ENSMGAP00000001232 ENSMGAP00000001232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]