SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001279 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001279
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-29
Family BAR domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001279   Gene: ENSMGAG00000001776   Transcript: ENSMGAT00000001932
Sequence length 117
Comment pep:novel scaffold:UMD2:GL424315.1:7709:8822:1 gene:ENSMGAG00000001776 transcript:ENSMGAT00000001932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERIAKRGRKLVDYDSARHHLEALQNAKKKDEAKIAKAEEEFNRAQAVFEELNRELREEL
PVLYGSRIACYVTIFQNISNLRDIFYKEMSKLNRDLYEVMGKLDKQHSSKVFIIKGV
Download sequence
Identical sequences H9H0B4
ENSMGAP00000001279 ENSMGAP00000001279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]