SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001511 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001511
Domain Number 1 Region: 497-614
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.89e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00083
Further Details:      
 
Domain Number 2 Region: 920-1045
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.00048
Further Details:      
 
Domain Number 3 Region: 266-382
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-24
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 
Domain Number 4 Region: 3-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000541
Family SAM (sterile alpha motif) domain 0.0035
Further Details:      
 
Domain Number 5 Region: 400-503
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000654
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 6 Region: 811-920
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000548
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 7 Region: 1157-1303
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000201
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 8 Region: 676-795
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000301
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 9 Region: 1119-1174
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000367
Family Ubiquitin-related 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001511   Gene: ENSMGAG00000001948   Transcript: ENSMGAT00000002173
Sequence length 1493
Comment pep:novel chromosome:UMD2:14:1832433:1845887:1 gene:ENSMGAG00000001948 transcript:ENSMGAT00000002173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPCTPDSDIADWLATIHLERYRDLFKQHGFHLARDVSALDNKQLQQLGITATGHRKRI
LNLAEKTRLLGYPHPRAPQQCGAMPSQAMPPQKDLDPPLVRPVPKPRTVFYRPKLEQGSA
AIPPAHSPDRDSNVGATGRPPSVPGVGQGRMEMVSNVIYEGLKENRVKGQAGLEGVCLPS
HRDLPASQVRAPGPLCAVGTPGCAQREDGPGGPIPCRTSSEYSSEGRSEDEETRTRLIER
IAQNDTEGYSTVDAPRAKGTPFSLPPHLYPDEVLDDLTISPYASYTSLSEPRPAMLSGWL
DKLSPQGNYVFQRRYVRFDGKNLMYFSSEKEPYPKGVIPLSVIEMVRSTKDNKFQVVTSH
RIFVFRAENETQRNEWCSTLQQKVTDQHLVGTRPRPPNTAHCQKSGTLELKGQKSKVFAV
LSLPEMWLYKSEQFFKMGIGICMIEMRGSTIREAKNRTFELITPSKIFSFVAESEREKRE
WMEALQEAIAETLYDYEVAEKIWSNKANRYCADCWAQSPDWASINLCVVICKQCAGQHRS
LGSNISKVQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAARIPASEVLHPDASTEQRRDF
ISRKYRDGRYRLPHPHYASQEDVLQALCTAVAGPGLLKTILQFFSAAEAGLAADPKAHEV
APVAEPWLDLERVPGPEGVYNEITQPVAYSGYLHRSMAHPRLPGAKKSREDFQRVWCSLE
RALLIFETEKCTEPLSHIQSGDLLSLGVSRAQPLSSPGPTERFHFTLELFLTGEKVQQLG
ADSADTLQAWASAIGKWFTPVSCHCLLGYEFQRVGQLRYKCMLNPERWQRAFFILQKAHL
FICPAEEDGAEDSINLRRLQELSLVPPAETPEKKEMLVLVEMGRTFYLQGLSRADTAAWY
ADIQASAGGRGNALRDQQLSRGDIPIIVDSCIAFITQYGLRHEGIYRKNGAKSRIKVLME
EFRRDARNVKLRISDNFIEDVTDVLKRFFRELEDPVFTLELHPQWKEAAAISSKPQRLER
YKELIHRLPRLNRKTLAALIGHLYRSATSPWVPQFDDVPQASLQGGISQRMLASVLVNQA
EPSAPCQWGEMMSMRDSSNIPKVVLQQTCLIFLCARPQVSPTMTAEELTNQVLEMRNVAA
SLDIWLTFEVLENGELERPLHPKEKVLEQALQWCKLPEPSAAYLLVRKVPIGEGSCLFTG
AKRETPKCGLLKCREEPPKLLGNKFYERYFVIRDRQLLLLKEKRSAKPEREWPLDVAKVY
MGIRKKLKPPAPWGFTLSMDKQQLDAHRVCTGQAELWDWITSILKTQHDDLRPVILRRRS
SSDLAKQKFGTMPLVPLHGDSTDATMLSANQTLRRLHTRRTLSMFFPMKVHQDSLEEQQE
KEMDTEPVYEEVGNFPELATLELQRGLLADPSPVPAMDRSQKPSSSPEQPPAPVLRSSLP
PSPAQRLPDPSITNTKKRSAQPSSPISDKLIQELSSIILKKSDSQTQGTGTGS
Download sequence
Identical sequences G1MT15
ENSMGAP00000001511 ENSMGAP00000001511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]