SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001640 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001640
Domain Number 1 Region: 391-557,857-1075,1130-1175
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-113
Family Ras GEF 0.0001
Further Details:      
 
Domain Number 2 Region: 538-624
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-18
Family PDZ domain 0.0043
Further Details:      
 
Domain Number 3 Region: 269-394
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000589
Family cAMP-binding domain 0.00083
Further Details:      
 
Domain Number 4 Region: 16-125
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000615
Family cAMP-binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 767-846
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000775
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001640   Gene: ENSMGAG00000001999   Transcript: ENSMGAT00000002304
Sequence length 1652
Comment pep:novel chromosome:UMD2:4:2704635:2828311:1 gene:ENSMGAG00000001999 transcript:ENSMGAT00000002304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFLSQQVKKEMVKLSNPPTKRSAMDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHE
ANEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIV
VDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPVGKPPLPRGYHTLPAD
FTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPETAVD
SEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVR
RELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSFGVSPT
MEKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTG
TRKGHIVIKGTAERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPS
LRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAKAKRR
LITLTKPSREAPLPFILLGGSEKGFGIFVDSVDFGSKATEAGLKRGDQILEVNGQNFENV
QLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRYSIPD
LAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYKCSDIGIGQSQDDS
IVGLRQTKHIPPALPVSGTLSSSNPDLLQSHHRILDFNTTPDLPDQVLRVFKADQQSRYI
MISKDTTAKEVVIQAIREFALTATPDAYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLS
GRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYI
DDLFKLKSKTGCTNLKKFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCRECK
NFNSMFAIISGLNLAPVARLRTTWEKLPSKYEKLFQDLQDLFDPSRNMAKYRNVLNSQNL
QPPIIPLFPVIKKDLTFLHEGNDSKVEGLVNFEKLRMIAKEIRHVGRMASVNMDPALMFR
TRKKKWRSLGSLSQGSTNAAVLDVAQAGGHKKRVRRSSFLNAKKLYEDAQMARKVKQYLS
NLDLEMDEESLQTLSLQCEPATNTLPKNTGDKRSGKSETSPVAPRAGIQQKVQQQQQHKA
NQALQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLDRHKKQSEDAVSSA
SSHLSSPPTSPQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSMPASLHDE
RRQRHSVSIVETNLGVGRIDRRIVIEPDQYSLGSYAPLSENRGLYSGATVLSSPSTEELS
QDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHAHFDNSGDGAGLWA
SGTHVDQLMFSDHGTKYSRQSQGREGLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGK
DVSIEAETSCVTSIPAEEAKPAPVPAHIPVTSSTTKGLIARKEGRYREPPPTPPGYVGIP
IAEFAEGVSHPTRKPPDYNVALQRSRMVARTCETHGTSAQQQQSHGHSASRPVNKPQWHK
PNESDPRLAHYQSQGFPTEEDVFAEDEQVSAV
Download sequence
Identical sequences G1MTB7
ENSMGAP00000001640 ENSMGAP00000001640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]