SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001786 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001786
Domain Number 1 Region: 376-552
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.21e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000232
Further Details:      
 
Domain Number 2 Region: 554-654
Classification Level Classification E-value
Superfamily E set domains 1.16e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001786   Gene: ENSMGAG00000002215   Transcript: ENSMGAT00000002453
Sequence length 903
Comment pep:novel chromosome:UMD2:3:4394050:4470367:-1 gene:ENSMGAG00000002215 transcript:ENSMGAT00000002453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEHYNYTSSNVNAGLPLNVAHSSLSTPCHGLQTSNPIISVVPSTNHPSGYGGHIDSGASD
YYLPPNIRPNGAPALESPRIEITSYMGLHHNNNQFFHDEVEEAIPNAKRSPSTATLNLPN
LEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYTSPQTSPWQSPCVSPKTTDTEEGY
QRGMVACTLLNSPRHSPSTSPRTSITEENWLGARSSRPPSPCNKRKYSLNGRQASYSPHH
SPTPSPQNSPRVSVTDETWLGNTNQYTSSAIVAAINALTTDSTIDMNDGIPIKSRKTAID
HTPSMTLKTEPAGEDHGTISPTADLSPEDFSSFQHIRKGNFCEQYLSVPQHPYQWAKPKS
LSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIV
QLHGYLESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHETILSNTKVLEIPL
LPENNMRATIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQSNGRTLSLQVA
SNPIECSQRSAQELPLVEKQSTDSFPVTGGKKMILTGHNFLQDSKVIFLEKAPDGHHVWE
MEAKTDKEMCKPNSLVVEIPPFRNQRITSPVQVNFYVCNGKRKRSQYQLFTYLPANAVPI
IKTEPTDDYEPAQTCGPMNQGLSPLSKPYYNQQIMMPPDPGSCLMAGFASCQQRNTVMSP
SPNASPKLHDLSSSPYKCIPNPGHSHLGLQQPAGGVPTIQEVPRSIVVHPSSPEQSSHIM
LQPQVSQHLSSSCPLGYQQTLYPNSPSSPVPSVTQEPTYLQSCSPTHSSIMGQQQQQLPK
VHRNESPTTQPLSLPELHEESNHNLAPIPVTIKREPEELDQMYLDDVVKILVASDITSFS
SHA
Download sequence
Identical sequences G1MTN6
ENSMGAP00000001786 ENSMGAP00000001786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]