SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001875 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001875
Domain Number 1 Region: 31-90
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-18
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001875   Gene: ENSMGAG00000002328   Transcript: ENSMGAT00000002545
Sequence length 99
Comment pep:novel scaffold:UMD2:GL424455.1:1391:3121:1 gene:ENSMGAG00000002328 transcript:ENSMGAT00000002545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPSEAAQLGTYGEEENGNRAGPPRSRLEPMDTIFVKNVREDGPAHQAGLRTGDRLVKVNG
DSIIGKTYSQVIALIQNSDNVLELSIMPKDEDILQLVSL
Download sequence
Identical sequences H9H0D9
ENSMGAP00000001875 ENSMGAP00000001875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]