SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002009 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002009
Domain Number 1 Region: 571-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-58
Family Nucleotide and nucleoside kinases 0.000000138
Further Details:      
 
Domain Number 2 Region: 407-521,564-598
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 3 Region: 151-246
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-28
Family PDZ domain 0.0000254
Further Details:      
 
Domain Number 4 Region: 47-150
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 304-366
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-17
Family PDZ domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002009   Gene: ENSMGAG00000002336   Transcript: ENSMGAT00000002681
Sequence length 762
Comment pep:novel chromosome:UMD2:9:1887853:1951801:-1 gene:ENSMGAG00000002336 transcript:ENSMGAT00000002681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPGKSAPKVNGSGPGWWPECTCSSRDWYEQANPAPIIVNTDSLEQGLSVNGSDGMFKYE
EIVLERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVD
VSEVVHSKAVEALKEAGPVVRLVVRRRQPPPETIMEVNLMKGPKGLGFSIAGGIGNQHIP
GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVA
KPGSLHLNDMYAPPDYTSTFSTLADNHISHNSSLGYLGGVESKPAYPAPPQVTPSRYSPI
PRHMIGDEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGD
RILSVPHRAELRTAPQPRVAALCARPGGAGPSGAVSATHEYSRFESKIHDLREQMMNSSM
SSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLV
TPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGV
TSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPTKDRVNDDLISEFPHKFGSC
VPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAER
GKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKVFDKAMKLEQ
EFGEYFTAIVQGDSLEEIYSKIKQIIEDQSGHYIWVPSPEKL
Download sequence
Identical sequences G1MU45
ENSMGAP00000002009 ENSMGAP00000002009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]