SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002094 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002094
Domain Number 1 Region: 379-683
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-89
Family p120GAP domain-like 0.000027
Further Details:      
 
Domain Number 2 Region: 250-360
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000253
Family PLC-like (P variant) 0.09
Further Details:      
 
Domain Number 3 Region: 183-249
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000548
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000002094
Domain Number - Region: 1057-1190
Classification Level Classification E-value
Superfamily Tropomyosin 0.0294
Family Tropomyosin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002094   Gene: ENSMGAG00000002477   Transcript: ENSMGAT00000002767
Sequence length 1219
Comment pep:novel chromosome:UMD2:10:4223598:4305225:1 gene:ENSMGAG00000002477 transcript:ENSMGAT00000002767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVKGPPTHRLSCGQSPYTETTTWERKYCILTDSQLVLLNREKEVPTEGLQEPQDATKGRC
LRRTVSVPSEGQFPEYPPDGASKLEVPAERSPRRRSISGTSTSEKTNSMDAANTSPFKVS
GFFSKRLKGSIKRTKSQSKLDRNTSFRLPSLRNADDRSRGLPKLKESRSHESLLSPGSAV
EALDLGAEEKVFVKPLHSSILGQDFCFEVTYSSGSKCFSCSSAAERDKWMENLRRTVQPN
KDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFYG
LPALHSITVHIYKDVEKKKKKDKNNYVGLVNIPMATVTGRQFVEKWYPVSTPTPNKGKSG
GPSIRIKSRYQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEEMACAMVHILQ
STGRAKDFLTDLVMSEVDRCGEHDVLIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKA
LYESDENCEVDPSKCSSSELTDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQC
LSRGKQDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDDRTSRTLTLIAKVIQNLANF
AKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNMPGFEGYIDLGRELSVLHSLL
WEVVSQLDKGENSFLQATVAKLGPLPRILADITKSMTNPTPIQQQLRRFTEHSSSPNVSG
SLSSGLQKIFEDPTDGDLHKLKSPTQENIDGYFRGKTLLLVQQASTQSMTYSDKDERESI
LPNGRSISLMDLQDPHTAHSDHASMMHDVPLRLAGSQLSITQVANIKQLWETQSTPQSAP
QVRRPLHPALNQQGSLQPLSFQNPVYHLNNPPAPMPKASVDSSLENLSTASSRSRSNSED
FKLSGPSNSSMEDFTKRSTQSEDFSRRHTVPDKHVPIALPRQNSSSQAQIRKMDQAGLGA
RAKAPQSLPHSASLRSTGSMSAVSGAVVTEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQ
TQQVQSPVDSATMSPVERTAAWVLNNGQYEEVEEDTEQNPDEAKHAEKYEQEIAKLKERL
KVSSRRLEEYERRLLVQEQQMQKLLMEYKSRLEDSEERLRRQQEEKDSQMKSIISRLMAV
EEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISP
TNPTKLSITENGEFKNSSC
Download sequence
Identical sequences G1MUA9
ENSMGAP00000002094 ENSMGAP00000002094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]