SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002102 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002102
Domain Number 1 Region: 810-1146
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-23
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 505-580
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000589
Family Pre-dockerin domain 0.056
Further Details:      
 
Domain Number 3 Region: 821-900,1116-1296
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000785
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002102   Gene: ENSMGAG00000002438   Transcript: ENSMGAT00000002775
Sequence length 2346
Comment pep:novel chromosome:UMD2:15:4306451:4414653:-1 gene:ENSMGAG00000002438 transcript:ENSMGAT00000002775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIYICFYFIGPWVTRNSSIDSGETEVGRKVTQEVPPGVFWRSQIHISQPQFLKFNISLGK
DALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVG
LWHLAFYNDGKDKEVVSFSTVILDSVQDCPRNCHGNGECVSGVCHCFPGFHGADCAKAAC
PVLCSGNGQYSKGTCLCYSGWKGPECDVPISQCIDPSCGGHGSCIEGNCVCSVGYKGENC
EEVDCLDPTCSNHGVCVNGECLCSPGWGGINCELPRAQCPDQCSGHGTYLSDTGLCSCDP
NWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGVACDQRVCHPRCTEHGTCKDGKCEC
REGWNGEHCTIGRQTTGTETDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETS
CADNKDNEGDGLVDCLDPDCCLQSTCQNSLLCRGSRDPLDIIQQSHSGSPAVKSFYDRIK
LLVGKDSTHIIPEENPFNSSLVSLVRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGM
FDLVANGGSSLTLHFERAPFMTQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRP
DPVIISSPLSTFFSDAPGRNPIVPETQVLHEEMEIPGTSIKLIYLSSRTAGYKSLLKIIM
TQSLVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQKVYGLSDAVVSVG
FEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHVLNVKSGILHKGNGENQFLTQQ
PAVITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRN
VTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYKVKSLTGTKDLAGNSE
VVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKYGLMYFVDATMIRKVDQNGIIS
TLLGSNDLTAVRPLSCDSSMDVSQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVS
IIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYISETDEKKINRLRQVTTN
GEICLLAGAASDCDCKNDVNCNCYSGDDGYATDAILNSPSSLAVAPDGTIYIADLGNIRI
RAVSKNRPILNSFNQYEAASPGEQELYVFNADGIHQYTLSLVTGEYLYNFTYSSDNDVTE
VMDSNGNSLKVRRDASGMPRHLLMPDNQIVTLAVGTNGGLKLVSTQTLELGLMTYNGNSG
LLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVI
TNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMSISFHSEPHVLAGTVTPTIGRCN
ISLPMENGLNSIEWRLRKEQIKGKVTVFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKF
TLRIIYDQLGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFA
DGKVWSYTYLEKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSVGYIRNIY
NPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTG
VLKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPII
SETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEM
FRSLMYWMTVQYDSMGRVTKRELKLGPYANTTKYTYDYDGDGQLQSVVNDRPTWRYSYDL
NGNLHLLNPGNSVRLMPLRYDLRDRITRLGDIPYKIDDDGFLCQRGSDVFEYNSKGLLTR
AYNKANGWNVQYRYDGLGRRASCKTNLGHHLQYFYADLHNPTRVTHVYNHSNSEITSLYY
DLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQLV
IGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNIGREPAPFNLYMFKSNNPLSN
ELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVSPPYELTESQACENGQLITGVQQ
TTERHNQAFMALEGQVISKKLHASIREKAGHWFATSTPIIGKGIMFAVKEGRVTTGISSI
ATDDSRKIASVLNSAHYLEKMHYSIEGKDTHYFVKIGSADSDLVTLAMTSGRKVLDSGVN
VTVSQPTLLINGRTRRFTNIEFQYSTLLINIRYGLTTDTLDEEKARVLDQARQRALGSAW
AKEQQKARDGREGSRVWTDGEKQQLLNTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQ
NEMGKR
Download sequence
Identical sequences G1MUB5
ENSMGAP00000002102 ENSMGAP00000002102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]