SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002142 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002142
Domain Number 1 Region: 35-291
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-79
Family Ras GEF 0.0000446
Further Details:      
 
Domain Number 2 Region: 459-576
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-16
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002142   Gene: ENSMGAG00000002513   Transcript: ENSMGAT00000002816
Sequence length 584
Comment pep:novel chromosome:UMD2:10:4347986:4459906:1 gene:ENSMGAG00000002513 transcript:ENSMGAT00000002816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQSSSVNIAATASEKSSSSESLSDKGSAELKKSFDAVVFDVLKVTPEEYAGQITL
MDVPVFKAIQPEELASCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE
VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKATFEKLEYVMSK
EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILESEQRTNLMNNILRII
SDLQQSCEYDIPLLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPHSAASRED
LVGSEVGASPQSGRKNVAAEGALLPPTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKS
ATFPNAGPRHLLDDSVMEPHVPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRL
YHSLGPGTRVSRNGYRGHMKASSSLESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVA
SWTKYWVALCGTQLFYYAAKSLKATERKHFKSTPSKNVSVVGWMVMMADDPEHPDLFLLT
DSEKGNSYKFQAGNRMNAMLWFKHLSAACQSNRQQVPANLMTFE
Download sequence
Identical sequences G1MUE5
XP_005231689.1.75256 XP_005435933.1.10750 XP_009970673.1.75343 XP_010148900.1.22856 ENSMGAP00000002142 ENSMGAP00000002142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]