SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002176 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002176
Domain Number 1 Region: 146-240
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.0057
Further Details:      
 
Domain Number 2 Region: 27-131
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 3 Region: 253-347
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000011
Family PDZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002176   Gene: ENSMGAG00000002575   Transcript: ENSMGAT00000002850
Sequence length 362
Comment pep:novel chromosome:UMD2:26:4516914:4518652:-1 gene:ENSMGAG00000002575 transcript:ENSMGAT00000002850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGCSNVASPTLYHCRKFEFNPKDGIDNPALSLAEDIAHADGEAVGEPRFYLLSKGSTETF
GFCLHEELGCRGHVIRQVEVGGLAQRRGLQDGDRLLQVNGLFVDHMEHHRVVQKIKASGN
QVLLAVLDGDSYEAAKALGRDLSQMLPADIRPRLCHITRDKSGFGFSVSGPEGVKGTFQL
SVRQDGPAERAGVPSGSWLLELNGHSVRSCSHTQLARKLKQSGSKVTLLVASGPVEEFYR
LRGLQVTAALADTSWLPFKVRELHMVKGDAGYGFLLKEDDYGSGAVGQFLWDIDAGLPAE
QGMEREGDRVLAVNGESIEGLDHQETVLRIRAHKEQVTLLVIDPASDAFYRSIGLSPLLF
LD
Download sequence
Identical sequences G1MUG8
ENSMGAP00000002176 ENSMGAP00000002176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]